KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_52Help
Entry
PHYPADRAFT_52     CDS       T01041                                 

Gene name
HAC1502
Definition
p300/CBP acetyltransferase-related protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHYPADRAFT_52 (HAC1502)
Transcription factors [BR:ppp03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    PHYPADRAFT_52 (HAC1502)
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    PHYPADRAFT_52 (HAC1502)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1082 aa AA seqDB search
RQQQYSKQQRWLLFLRHASKCTASEGQCQITPHCHMAKQLWIHIASCQDRECTFSRCNAS
RTLLHHHQHCRDARCPVCGPVRQQVMNQQRVQASSLAAHQGGAAAPVSNSATAGMSSTDL
SPSGIESCPTSEAPTFEDIDGQQPPPKRAKTEPSSVNNVPLPVSTTLLSGPSKSAAAKAS
SVLLSAPSQAVGEKSEQVTVKTEIVASSGPVSAKAEEQLNGHQTGVLLPSGLTSAKLEAP
IQAKTEPRQPVSNAAVKSEPHNGSASTPAKGEPGVGAALMNNATVISTKTGKPKNLGTSL
TELFTPEQIREHITGLRQWVGQSKAKAEKNQALSENQISENACQLCAVEKLTFEPPPIYC
TACGVRIKRNALYYTFGSGDARHYFCVPCYNEVRSENVEMEGMTYPKSKLEKRKNDEETE
EAWVQCDKCNLWQHQVCALFNGRRNEGDSEYICPECCCVEMERGERKPLPPSAVLGAKDL
PKTFLSDHLEQRLARKLKQERAERAKAQGKNIDEVASAEALVVRVVSSVDKKLEVKQRFL
EVFQGDYPTEYPYKSKVVLLFQKIEGVEVCLFGMYVQEFGVECSLPNQRRVYLSYLDSVK
YFRPDVRTVNGEALRTFVYHEILIGYLDYCRRRGFSSCYIWACPPLKGEDYILYCHPEIQ
KTPKSDKLRDWYLAMLRKASTDGIVVEITNLYDYFFTSTGECKAKVTAARLPYFDGDYWP
GAAEDMIVQLQQEEEDVRNNVLKKGKTKKQPTKRSSKVIVQTELPGNASKDTQLMQKLGE
SIFPMKEDFIMVHMHHACSHCRLFIVCGRRWVCKQCKSFQLCDKCYDAEQKLDERDRHPI
NMKELHSFQSVEIHDVPSDTKDKDEFMESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSM
MVLYHLHNPTAPAFVVSCNICHQDIEAGNGWRCETCADFDLCNKCKDSAKHPHKLTPFHD
RNAQNKEARQQRVLQLRKMLELLVHASQCGLGSCQYPKCRSVKGLFRHGMNCRIRASGGC
NMCKRMWYLLQLHARACKESECRVPRCKDLKEHLRRLQQQMESRRRVAVMEMMRQRAAEA
AG
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
aggcagcaacaatactcaaagcagcagagatggttgctgtttttacgtcatgctagtaag
tgtacagcttcggaagggcagtgtcagatcacacctcactgtcatatggcaaagcagctc
tggattcacatagcatcatgccaagatcgtgaatgcacattcagcagatgtaatgcatct
cgcaccttgcttcaccatcaccagcattgtcgtgatgcccggtgtccagtttgtggacct
gtacgccagcaagttatgaatcaacaacgagtgcaagccagttctctagctgcacatcag
ggaggagcagcagcacctgtgtccaactctgccactgcaggcatgtcatcaactgatttg
tctcccagtgggatagaatcatgtcctactagcgaggctccaacttttgaggatatagat
gggcagcagccacctccgaagcgtgctaaaaccgaaccgtccagtgttaacaatgtacct
ctgccagtatctactactctgctctctggacccagtaagtcagcagctgccaaagcaagt
tctgtactattatcagcaccctcccaagctgtgggggaaaaatctgagcaagttacggtg
aagacagagattgtggccagctcgggacctgtatcagccaaggcggaggagcagttaaat
gggcaccagactggtgtactcttgcctagtggccttacaagtgctaaactagaggctcct
attcaggcaaagacagaacctcgtcagccagtgtcgaatgcggcagtcaagtctgagcct
cacaatggcagtgcttccactcctgcgaagggtgaacctggtgtaggtgccgcgctaatg
aataatgcaacagttatttcaacgaagaccggaaaacccaagaatttggggacatcgctg
acagaactcttcacacctgagcagatacgtgagcacattacaggcttgcgccaatgggtt
ggccagagcaaggccaaggctgagaagaatcaggccctcagtgagaatcaaataagtgag
aatgcatgccaactatgtgctgtggagaagctaacattcgaacctcctccaatctactgc
actgcgtgtggggtccgtataaaaaggaatgctttgtattacacctttggctcaggcgac
gcgagacactacttttgtgtgccctgctacaatgaagtgcgatctgaaaatgtggaaatg
gaaggcatgacttatccaaaatcaaaattggagaagcggaagaatgacgaagaaaccgag
gaggcgtgggtacaatgcgataagtgcaacttgtggcagcatcaagtttgtgccctattc
aacggtcgccgaaatgaaggagatagtgaatatatttgtccagagtgttgctgcgtagaa
atggaaaggggtgaacgtaaaccgctgcctccttctgcagtcttgggcgccaaagatttg
cccaaaaccttcctaagtgatcatttggagcaacgtttagcgcgcaaacttaaacaggag
cgtgctgaacgggcaaaagctcaagggaaaaatatcgatgaggttgccagtgcagaggct
ttggtggttagagttgtatcctccgtggacaagaagctggaagtgaagcaacggttcttg
gaagtttttcaaggagattatccaactgagtatccgtataagtcaaaggttgttttgctg
tttcaaaagatagagggggtagaagtttgtctcttcggcatgtacgttcaagagtttggg
gttgaatgctctcttccaaatcagcgaagggtgtacctgtcatatctggactctgtgaaa
tattttcgcccagatgtcaggactgttaatggagaggctttgcggacttttgtttaccat
gaaattttgatcggctatctagattactgtcggaggagaggttttagtagctgttacatt
tgggcttgcccacctctaaagggagaggattatattttatattgtcatccggaaattcaa
aaaacgcccaagtctgacaagcttcgagattggtacttggcgatgctgcggaaagcaagc
accgatgggattgttgttgaaatcacaaatctatatgactacttttttacctcaactggc
gagtgcaaagcgaaggtgacagcagctcgtttgccatactttgatggtgactactggcca
ggcgcagctgaggacatgatagtacaattgcagcaggaagaggaggatgttcgcaacaac
gtcttgaagaaaggcaagactaaaaaacagcccaccaaacgttcttctaaagtaatagtc
caaactgagctgcctggcaatgccagcaaagacacccagctcatgcaaaagttgggagaa
tctatctttccgatgaaggaggacttcataatggtgcatatgcatcatgcatgctcccac
tgccgtctctttattgtttgtggtcgccgctgggtttgtaaacaatgtaaaagctttcag
ctttgtgacaaatgctatgatgcagaacaaaagcttgatgagagggacagacatcctatc
aacatgaaagaattacattctttccagtcggttgaaatacacgacgttccaagtgacacg
aaggataaagatgaatttatggaaagcgagttctttgacactcgacaagcgttcctgagt
ttgtgccaagggaaccactatcaatatgacacattgcgacgtgcaaaacattcgtccatg
atggtgctttaccatttgcacaacccaacagctcctgcatttgtggtaagctgtaatata
tgtcatcaagatattgaggcgggcaatggttggcggtgtgaaacttgtgcggactttgac
ctttgtaataagtgcaaagactcagcgaagcacccacacaaacttactccgtttcacgat
cgaaatgcccaaaacaaggaagctcgtcaacagcgggttcttcagttgcggaaaatgctc
gagttactcgtacacgcatcacagtgcggattaggatcctgccaataccccaaatgtcgg
agtgtgaaaggcctttttcggcatggcatgaactgcaggatcagagcctctggaggctgt
aacatgtgcaaaagaatgtggtaccttctacagcttcatgcaagagcttgcaaggaatcc
gagtgcagggtccctcgttgcaaggatttaaaggagcatttgcggcgtctacagcaacag
atggagtcacggcgaagagttgcggttatggaaatgatgcgccaaagggcagctgaagct
gcaggc

DBGET integrated database retrieval system