KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_56064Help
Entry
PHYPADRAFT_56064  CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Membrane trafficking [BR:ppp04131]
 Others
  Actin-binding proteins
   Others
    PHYPADRAFT_56064
Cytoskeleton proteins [BR:ppp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     PHYPADRAFT_56064
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHYPADRAFT_56064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQSYVDDHLMYPLPTGHSLVAAAIIGHDGSVWAQSEMFPQLSSTEVEKLLDGFEDGSL
LAENGLFLGSAKYMVLQGEAGVVIRGKKGAGGCTVKKTNSAFVIGLYDYPVTPGECNMVV
ERLGDYLCDQGL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagtcgtacgtcgatgaccacttgatgtacccgcttccgacggggcatagt
ctggtggccgccgccatcatcgggcacgatggaagtgtttgggcgcagagcgagatgttt
ccgcagttgagctcaacggaggtggaaaagcttctggatggtttcgaggacgggagcttg
ctggccgagaacgggctgtttttgggaagcgccaagtacatggttctgcagggtgaagct
ggcgttgtgatccgggggaagaagggtgcaggagggtgcacagtgaagaagacgaacagc
gcgtttgtgatcgggctgtacgactatccagtgacgccgggcgaatgcaacatggtggtg
gagaggctgggggattatctgtgcgatcaggggctttga

DBGET integrated database retrieval system