KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_57037Help
Entry
PHYPADRAFT_57037  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PHYPADRAFT_57037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 218 aa AA seqDB search
MQWHCHGANYEELISNLQKRGILTSLHAAAAMSKVDRKLFVPATGYAYNDSPQVIGYGAT
ISAPHMHSYCLSLLADHAKPGMSVLDVGSGSGYLTAVFGLMVGETGRVVGVEHIAELVEG
SIDAIKETPAGELMDKGRIEVYVADGKLGYEEAGPYDCIHVGAAAAVLPEALVKQLKPGG
RMVIPVGSDNQDLVIIDKLQDGTIKKTVDMVVRYVPLI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcactgccacggcgccaactacgaggagctcatctccaatttgcaaaagcgg
ggcatcttgacttcgttacatgcggcagctgccatgtctaaggtggaccggaagctgttt
gtgccagccactggctacgcttacaacgactcccctcaagtcattgggtacggagcgacg
atatccgcccctcacatgcattcctattgcctatcattactggcggatcacgccaagcct
ggcatgtctgttctcgacgttggctcaggatctggatacctgactgcagtctttggttta
atggttggagagaccggccgtgtcgtcggtgttgagcacattgcggaacttgtggaaggc
tcaattgatgctatcaaggaaacacctgctggcgaacttatggacaagggaagaatcgaa
gtatatgtggccgatggaaagcttggatatgaggaggccggaccatatgactgcattcac
gtcggcgctgctgctgcagttcttcctgaagcacttgtgaaacaactcaaaccaggaggc
cgaatggtcattccggtgggatcagataaccaggatttggtgatcatagacaagctgcag
gatggaacgatcaagaagacagtagacatggtggtccgatatgtgccccttatctag

DBGET integrated database retrieval system