KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_59769Help
Entry
PHYPADRAFT_59769  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PHYPADRAFT_59769
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PHYPADRAFT_59769
    2.7.1.82  ethanolamine kinase
     PHYPADRAFT_59769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 323 aa AA seqDB search
MLHKLARKWTDILDPKDLTLTRLKGAMTNYVYQCHWERDNGHRPRTVLVRIYGEGSSMFF
NRNDEVLTFELMSQKGQGPHLLGRFPNGRVEEFLRARTLEKHDLRDPEISKRIAEKLQEF
HSLDMPGPRKAKLWERLRDWLVKIFEHSDSTEEDFGINKLDDEINDLQRRLMKPDTRIGF
CHNDLQYGNIMVSEKDDSITLIDYEYASYNPVAFDIANHFCEMTADYHSDEPHLLNQASF
PDYEERSRFCRAYLEASGDSATQIDVERFVKEVDEFVVASHLHWALWGLLSAAHQDVEFD
FFSYSRQRFAEYYRLKHDLFGSR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacaagttggctcgaaaatggactgacatcttggatcccaaagatcttactttg
acacggctcaaaggtgccatgacaaattatgtttaccagtgccactgggaaagagacaat
ggtcaccgccctcgcacagttcttgtgcggatttatggagaaggttcgagcatgtttttt
aacagaaacgatgaagtgctcacgtttgagttgatgtcgcagaaaggtcaaggaccgcac
cttctgggtcggttccctaatggtcgagtggaagaattcttgcgagcacggacactcgag
aagcacgacttgcgagatccagaaatttcgaagagaattgctgagaaactgcaggaattt
cacagtctcgacatgcctgggccacggaaagccaagttgtgggaacgcctcagggattgg
ttggtgaagattttcgagcattccgattctactgaagaggactttggtatcaacaaattg
gacgatgaaatcaatgacttgcaacgccgattgatgaagcctgatactcgaattggtttt
tgtcataacgacttgcaatatggcaatatcatggtttcagagaaggacgactctatcaca
ctcatagattatgagtacgccagttacaaccctgtggcatttgatattgccaatcatttc
tgtgaaatgactgcagattatcattctgacgagcctcatttgttgaatcaagcaagcttc
cctgactacgaagaacgaagccgattttgccgtgcgtatctggaagcttcaggggactca
gctacccagattgatgtggagagatttgtgaaagaagtggacgagttcgtggttgcgagt
cacctacactgggctctttggggtttgttgtcggctgcgcaccaagatgtggagttcgac
ttctttagttattctcggcagcgatttgcagaatactacaggctgaaacatgatttgttt
gggagtagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system