KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_61927Help
Entry
PHYPADRAFT_61927  CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     PHYPADRAFT_61927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 257 aa AA seqDB search
MHGLCLLAPATFSWDALGVSLGLYVITGLFGITLSFHRNLSHKSFKLPKWLEYSFAYCGV
QAVQGDPLEWVSSHRYHHQHCDTEKDPHSPYEGFWHSHMGWLLDDRRTQERVGARNNVGD
MDKDPFYQFIQRTYPIHPIMMAVALYVMGGFPYLIWGMALRVVWVYHITWFVNSASHVWG
SQKWNTGDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWQLDPTWWIICALEAVGV
ATKVKLPKKEHMEKLAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggttgtgtttgttggctccagccaccttttcttgggatgctttgggtgtctct
ctcggtttgtatgttattacgggcttgttcgggatcacgctctccttccatcgcaatctg
tcacacaaaagcttcaagctccccaagtggttggagtactctttcgcgtattgtggagtc
caagcggtccagggtgatccattggagtgggtaagctcacatcggtatcaccaccagcat
tgtgacacagagaaagatccacattctccttatgaaggtttctggcacagtcacatggga
tggttactggatgacagaagaactcaagaaagagtcggggctcggaataacgttggtgac
atggacaaagatcctttttatcagtttattcagcggacatatccaattcatcccatcatg
atggcggtggcgctgtatgtcatgggtggatttccttacctaatttggggcatggcttta
agagttgtgtgggtctatcacattacgtggtttgtgaactcagcatctcatgtttggggc
tcacaaaagtggaatacgggtgatttatcaaggaataactggtgggtggcacttcttgca
tttggagaaggttggcacaataaccatcatgcttttgaatattcagcgaggcatggactt
gaatggtggcagctagacccaacatggtggatcatttgtgctcttgaagctgttggagta
gctacaaaggtaaagctcccgaagaaagagcacatggagaagttagcactttag

DBGET integrated database retrieval system