KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_61927Help
Entry
PHYPADRAFT_61927  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppp01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 257 aa AA seqDB search
MHGLCLLAPATFSWDALGVSLGLYVITGLFGITLSFHRNLSHKSFKLPKWLEYSFAYCGV
QAVQGDPLEWVSSHRYHHQHCDTEKDPHSPYEGFWHSHMGWLLDDRRTQERVGARNNVGD
MDKDPFYQFIQRTYPIHPIMMAVALYVMGGFPYLIWGMALRVVWVYHITWFVNSASHVWG
SQKWNTGDLSRNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWQLDPTWWIICALEAVGV
ATKVKLPKKEHMEKLAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggttgtgtttgttggctccagccaccttttcttgggatgctttgggtgtctct
ctcggtttgtatgttattacgggcttgttcgggatcacgctctccttccatcgcaatctg
tcacacaaaagcttcaagctccccaagtggttggagtactctttcgcgtattgtggagtc
caagcggtccagggtgatccattggagtgggtaagctcacatcggtatcaccaccagcat
tgtgacacagagaaagatccacattctccttatgaaggtttctggcacagtcacatggga
tggttactggatgacagaagaactcaagaaagagtcggggctcggaataacgttggtgac
atggacaaagatcctttttatcagtttattcagcggacatatccaattcatcccatcatg
atggcggtggcgctgtatgtcatgggtggatttccttacctaatttggggcatggcttta
agagttgtgtgggtctatcacattacgtggtttgtgaactcagcatctcatgtttggggc
tcacaaaagtggaatacgggtgatttatcaaggaataactggtgggtggcacttcttgca
tttggagaaggttggcacaataaccatcatgcttttgaatattcagcgaggcatggactt
gaatggtggcagctagacccaacatggtggatcatttgtgctcttgaagctgttggagta
gctacaaaggtaaagctcccgaagaaagagcacatggagaagttagcactttag

DBGET integrated database retrieval system