KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_65109Help
Entry
PHYPADRAFT_65109  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    PHYPADRAFT_65109
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     PHYPADRAFT_65109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 420 aa AA seqDB search
MGTRCTQSWPPQPPSATLLATLSWYTMVRADGSVEKACRHFFQFGIRGIKDVWPFPSQRA
CKLVGAFVLFEAILQALLPGERVMGPSTPVGNRPLYTRNGIPCFLITLGVYYLLWRERLF
NPAMVYDIIGEIYSVLICATYITTTLLYVKGHMAPCSSDWGSSGNVLGDFFWGMELCPRL
SSVFDIKVFMNYRLGIMGWAILVISFAIKQYEVQGRVSDSLMVSSLLMLMYIAKFFWMEA
AFGCSMDIAHDRAGWFMTYTCVTWIPVVNSSVNLYLVTHPIQLGRRMASTIFLLGMLCIY
VVWDCDRQRQLFRNSHGKCQIWGRIPTKIQARHQTERGERKSLLLTAGWHIHYAPEIGAA
FFWTLPALFRHAMPYFYVTFLTALLIDRANRDDKYCRVKYHKHWEAYSKKVRYKVVPRVF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgggaacacggtgcactcaatcttggccccctcagcctccctctgctaccctccttgcc
actctttcgtggtacacgatggtgagagcggatggatcggttgagaaagcatgtaggcat
tttttccagtttggaattcgtggcatcaaggatgtttggccattcccctcacaacgcgct
tgtaagctggttggagcttttgttttgtttgaagctattttacaggcccttttaccaggg
gagcgggtcatgggtccttcaacgcctgtaggaaatcgacccctttacacgagaaatgga
attccctgctttctgatcactctaggtgtttactaccttctgtggagggagagactgttc
aatccagccatggtttacgatataattggagaaatatactctgtgctcatttgtgcaact
tacatcactactacattgctctatgtgaaaggtcacatggcaccttgttcctctgactgg
gggtcatctggcaatgtccttggggatttcttttggggaatggagttgtgcccaagatta
tcaagtgtatttgacatcaaagttttcatgaattatcgccttggaataatgggctgggcc
attcttgtaatcagctttgctatcaagcaatatgaagtccaaggcagagtttcagactct
ctaatggttagtagcttactcatgcttatgtacatcgcgaagtttttctggatggaggca
gccttcgggtgttccatggatattgctcatgatagagctgggtggtttatgacctatacc
tgtgtgacatggattcctgtggtgaattcatcggtcaacttgtacttggtgacacatcca
attcagctcggcagaaggatggcatcgacaatatttcttcttggaatgctttgcatttat
gtagtttgggactgtgatcgacaacgccaactgttccggaactctcatgggaaatgccaa
atctgggggaggattcccaccaagattcaagctcgtcaccaaacagagcggggagagcgc
aagagtctgcttcttactgctggctggcatatccattatgctccagagattggtgctgcc
ttcttttggaccctaccagctctctttagacatgctatgccttacttctatgtaactttc
ttgacggcgctgttgattgaccgagctaatcgggacgacaaatattgcagagtcaagtac
cacaagcactgggaagcctacagcaagaaggtgcggtataaagttgttcccagagtcttt
tga

DBGET integrated database retrieval system