KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_68636Help
Entry
PHYPADRAFT_68636  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHYPADRAFT_68636
  Lipid metabolism
   00561 Glycerolipid metabolism
    PHYPADRAFT_68636
   00600 Sphingolipid metabolism
    PHYPADRAFT_68636
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    PHYPADRAFT_68636
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PHYPADRAFT_68636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 402 aa AA seqDB search
MDSLRLHPWGISWNSWNHFACNVNETVIFETADALVSTGLAAKGYKYINLDDCWAALQRD
SQGNLLARATTFPSGIKALADYVHSKGLKLGIYSDAGYYTCASQPGSLGHETQDAQTFAS
WASFLSTSAILTIIHRSRMEIDYLKYDNCFTDGTKPEYRYPVMRDALNKTGRPIFFSMCE
WGIDSPATWANNVGNSWRTTGDITDDWNSMVGIVELNNVWADYAAPGGWNDPDMLEVGNG
GMTVEEYRSHFSLWALMKARSFAPLLIGCDVRNIGAEILEILANEEVIAVNQDPLGVQGK
RVRMDGFSGLEVWSGPLSSGRVVLLLWNRSSESANITARWSDMGIPNDTLLTVRDLWKHE
TISEAEMYEICQEVPSHGVKMFILTPVSQIYLKRESYSHKMD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggactcgcttcgactccacccatggggtatttcatggaacagctggaatcacttcgcc
tgcaatgtgaacgagactgttatttttgaaacagctgatgcgctcgtatcaacaggtcta
gctgccaagggttacaaatacatcaacctagatgactgctgggctgcattgcagcgtgac
agtcagggtaaccttctggcacgcgcgacgactttcccttcaggaatcaaagcactggca
gattatgtgcatagcaagggtcttaagcttggaatatactcagatgctgggtattacact
tgtgcatcccagccaggttcgcttgggcacgagactcaagatgcccagacatttgcttca
tgggcaagcttcctttctactagtgctatactcacaatcattcacaggtcgagaatggaa
attgactatctcaagtatgataactgttttaccgatggaaccaaaccggagtacaggtat
cctgtcatgcgggatgctttgaacaaaacaggtcgtccgatattcttctcaatgtgtgaa
tggggtattgacagtccagcaacatgggcaaataatgttggaaacagctggcgcacaact
ggtgacattactgacgactggaatagcatggttggtattgttgaattgaataacgtatgg
gcggactacgccgcacctggtggttggaatgatcctgacatgttagaagttggcaatgga
ggaatgacggtagaagaatatcgatctcacttcagtttgtgggcccttatgaaggcaaga
tctttcgcaccacttcttattggatgtgatgtgcgcaacattggggccgaaattcttgag
attcttgcaaatgaggaagtcatagcagtaaatcaagacccccttggggtacaagggaaa
cgagtacgaatggacggattcagtgggcttgaggtatggtcggggccgctgtcttcgggc
cgtgtcgtattgttactgtggaaccgaagcagcgaatctgccaacatcaccgcaagatgg
tctgacatggggattccaaatgatacccttttaactgttagagacctctggaagcatgaa
acaataagcgaggctgaaatgtacgagatctgccaagaggtaccttctcatggggtcaag
atgtttatcttaactcctgtaagccagatctacctcaaacgggagagttatagccacaaa
atggactaa

DBGET integrated database retrieval system