KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_78838Help
Entry
PHYPADRAFT_78838  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHYPADRAFT_78838
Translation factors [BR:ppp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PHYPADRAFT_78838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 349 aa AA seqDB search
MERKKENDEETPLKAPFCNCGPKLLRPQFCGLDCAFLWHCFGAVSEPPSAQLIVHCPVET
WLFAKTTWPCLHIAPLAFRAPVGFLVSVNARLHDNLGLSVTDCMLLLLSLSMLPFRVVRK
CVSVLRSDLVCISFVNSESEGFVVSLPVMGSDETKRNSQWDDEDKEEEPQEEKKKHTGWS
DGGSLSPQEVGSKPKEHEKSNKTADDDGVVSDPLVEKLRQQRSVEEADYQNTSELFGIKS
RGGVSLNDFIPKSEDDILEYAEMISRKIRPFERSFHYMTLLRALLRHSVASMKGSDAKEV
ASSMTAIVNEKLKAERKAAAGKKKTSTCIPISSVKLLKIVLKLYFLSEN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaagaaagagaatgatgaggagacccccctcaaagctcccttttgcaactgt
ggccccaaactccttcgacctcaattttgtggcctggattgtgcctttctttggcactgc
tttggtgccgtttcagaaccaccttcagctcagctcattgttcactgtccagtggagact
tggctctttgctaaaaccacatggccatgtttgcacattgccccgcttgcgtttagagca
cctgtcgggtttcttgtctctgtcaatgctcgtttgcatgataacttgggtctttctgtg
actgactgtatgttactactgctatcgttgtcgatgctaccgtttcgagttgtcagaaaa
tgcgtgtcagtgcttcggtcagatcttgtgtgtatatcgtttgtaaactcagaatccgaa
ggttttgttgtctcgctcccggtgatgggcagtgatgaaaccaagagaaatagccaatgg
gatgatgaagacaaagaggaggaacctcaagaggagaagaagaagcatactggatggtct
gacggtggatctctatcaccacaggaggttggatctaaacccaaggaacatgagaaaagt
aataaaacggctgatgatgatggggttgtttctgatccattggtggagaagctgcgtcaa
cagaggtcggttgaggaggctgattaccagaacacatcggagctttttggaatcaagtct
aggggaggtgttagtttaaacgattttatcccgaaatccgaggacgatattctagaatat
gctgaaatgatttctcgaaagataagaccatttgagagaagtttccattacatgacactt
ctgagggcgttgttgcggcattcagttgcaagcatgaaaggctcggacgccaaggaggtt
gcatccagcatgactgcaattgttaatgagaagttgaaagccgagaggaaagctgccgct
gggaagaagaagacaagtacttgcatacccatttcctctgttaaattgttgaaaattgtt
ttaaaactgtatttcttgagtgaaaactga

DBGET integrated database retrieval system