KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_78935Help
Entry
PHYPADRAFT_78935  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHYPADRAFT_78935
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHYPADRAFT_78935
Transcription machinery [BR:ppp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PHYPADRAFT_78935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 621 aa AA seqDB search
MGSKNFEHREHEHRENRRDDASRLVPCEHLAEYRARNGSESLRVLQRCVKTEASGRACIK
REAKEVPRCGSCSRARGRLYACVVCGTIGCWSPPDALHARTHAQDNPGHGIAVDIERAEL
FCCFCGDQVYDVDFDRAIIAARADVLRRETEERRRNAGDVGDNLKKNVGSGCGRDGCGDF
GAGSRTVSGLVVSSPCGGEVGNSHESRKRRRSIEYKPWVASGQEQLGLKQSSTPLNDGKK
LPAGLRGLNNLGNTCFMNSVLQALLHTPPLRNYFLSDRHNQAMCQRGDAQLCLGCDMDII
FTAAFSGDRTPYSPANFLYSWWRYASNLAGYEQQDAHEFFISLVSGIHDEGGTTSSCKTT
RSGDDNCHCKVHRVFSGLLRSDVTCTVCDLTSTTYDPCVDISLDLEPDFGTEKGFSESII
HAEHGGRTSRAASSASGASSLLGCLDRFTRPERLGANEKSFCERCQTRQESIKQMSIRKV
PLVLCFHIKRFDFTRNQPKKLDRYVQFPLFLDLLPYMSSSIVRLRHGNRLLSVSGDASNL
PPSQSPSEFELFAVVTHSGKLDSGHYVSFLRLNKCWYKCDDAWITRVTEDYVRASQAYML
YYVQKTLFYKASDTARPPMGG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaagaatttcgagcatcgtgagcatgagcaccgggagaatcggcgggacgat
gcatcgaggctcgtgccgtgtgagcatttggctgagtaccgcgcacggaatgggtcggag
agtttgcgagtgctgcagaggtgcgtgaagacggaggcctcggggagggcttgcatcaag
cgggaggccaaggaggtgccgcggtgcggtagctgctcgcgggcgcgggggaggttgtat
gcgtgcgtggtttgtgggactattggctgctggagcccgccggatgcgctgcacgcgcgg
acgcatgcgcaggataaccccgggcatggtatagctgtggacattgagcgtgcagagctt
ttttgttgcttctgtggcgatcaggtatacgatgtggatttcgatcgagcaattattgcg
gcgcgggcggatgtgctgcggcgggagacagaggagaggcggagaaatgcgggtgatgtg
ggtgacaatcttaagaagaatgtggggagcggatgtggcagagacggatgtggggatttc
ggggcggggtcgcgtactgtgtcgggtttggttgtgtcttcaccttgcggtggggaagtt
gggaatagccatgagtcgaggaagcgaaggagaagcatcgagtataagccgtgggtggca
tcgggtcaggagcaattgggtttgaaacagagctccacgcctttgaatgatggcaagaag
cttccagctggtttaagaggccttaataatcttggaaacacgtgtttcatgaattccgtg
ctgcaagcacttctccacacaccaccattgcgaaattattttttgagtgaccgtcacaac
caagccatgtgccagcggggggatgcacagctttgccttggttgtgatatggacatcatc
ttcactgcagctttttcaggagatcggacgccttacagtccagccaattttttgtacagc
tggtggcgatatgcttcaaacctggcagggtacgagcagcaagatgcacacgaatttttt
atttccttagtctctggcatacatgatgaaggaggcacaacctcctcgtgcaagacgacg
aggtccggagatgataattgccattgcaaagttcaccgtgttttctcaggacttcttcgg
tccgatgtaacatgcactgtatgtgatttaacctccactacatatgacccctgtgttgat
atttcgttagaccttgagcccgactttggaacagagaaaggcttctcagaatcaataata
catgctgaacatggtggccggacgtctagagcagcttcaagtgcttcgggggcttcctca
ttgctgggttgtttagaccgttttaccagacctgaacgcttgggagcaaacgaaaagtct
ttctgcgagagatgtcaaactcgacaggaatctatcaagcaaatgtctattcggaaagtc
ccactagttctgtgctttcacataaagcgctttgatttcactcgtaaccagcccaagaag
cttgatcgctatgtgcagtttcctttatttcttgatttgttaccgtatatgtcatcttct
attgtaagattgaggcatggcaataggctcttgagtgttagtggtgatgcaagtaatctt
ccaccctcacaaagcccgtcggagtttgagctttttgctgtagtcactcattccggtaag
ctagactcgggacactacgtatcgtttctgcgtctcaacaagtgttggtacaaatgcgat
gatgcttggattactcgcgtaactgaagactatgtccgagcctcgcaagcctacatgctc
tattatgtccagaagacccttttttataaagctagtgacacagcccgtcctccaatgggg
ggatag

DBGET integrated database retrieval system