KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_80742Help
Entry
PHYPADRAFT_80742  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PHYPADRAFT_80742
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     PHYPADRAFT_80742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 332 aa AA seqDB search
MEFIATYTRKRKQGAGLVVDSKPDFTEFEFSHVGGGGGVKKLEGYSRRGKKAKKERQDEN
GERRDGGQALVDEEEDTKTYRRKSIGGRKSTTRGGGCDALLKVVDDMVAALAPLKFRLPV
AFVYNPLEYARKPHEEYVRKYGGKIVEVLLVSMNPGPFGMTQTGVPFGDSVFAREFLHIT
SEVEFPEKMHPKRPVIGLNCPRREVSGQRVWSWVQARFGTASAFFDRFWIHSYCPLLFVE
SSGKNRTPDKLTPSEKASITSVCNEALRGVIAVTKPRVIVGVGKYAGDRVKECAPPGAQV
GDIMHPSPANPKAKKDWDKLIEGQLRALGVDI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaattcatagctacctatactcggaaacggaagcaaggggcgggacttgttgttgat
tcgaagcccgattttaccgagtttgagtttagtcatgtgggtggagggggaggggtgaag
aagctggaagggtattcgagaagggggaagaaggcgaagaaggagagacaggatgagaat
ggcgagaggagagatggaggacaagctcttgtcgatgaggaagaggacacgaagacttat
aggcgtaagagtatcggtggaagaaaatcaactacgcgcgggggaggatgtgacgctctg
ttgaaggttgtggatgatatggtagcggctcttgctcctctcaagtttcggctgccagtt
gcatttgtatacaatccactggagtatgcaagaaaacctcacgaagagtatgtgcgaaaa
tatgggggtaagatagtagaggtattgcttgtgagcatgaacccaggtccctttggaatg
actcagacaggagtgccttttggagatagtgtgtttgctcgtgaatttcttcatataaca
agcgaggttgaatttccagaaaaaatgcatccaaagcggcccgttattggcctgaactgt
cctcgtcgtgaggtgagtggacaaagggtatggagttgggtacaagctcgcttcggcaca
gctagtgcatttttcgatcgcttttggatccacagttattgtccccttttgtttgtagag
agttctggcaaaaaccgtactccagacaagttgactccctctgagaaagcttcaattaca
agtgtttgtaatgaagctcttcgaggtgtcattgctgtgacgaaaccccgtgtaattgtt
ggtgtaggaaaatatgcaggtgacagagtaaaagagtgtgctcctcctggagctcaagtg
ggagacattatgcatccaagccctgccaatcctaaagcgaaaaaggattgggacaagctc
atcgaaggccaactgcgagctctaggcgtggatatatag

DBGET integrated database retrieval system