KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_88235Help
Entry
PHYPADRAFT_88235  CDS       T01041                                 

Gene name
HAG1503
Definition
RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 573 aa AA seqDB search
MAATDIPLALEQQQKKKKPAPGRGGVTATLSEDEALLRCIGEIVDAMVQGCRKGESVDLN
ALKSEACKRYGLSRAPKLVELIAALPESEREMVLPRLRAKPVRTASGIAVLAVISKPHRC
PHIATTGNIFYSTQLYTGYGPTSMRAIRARYNPYVQARGRIDLLKRLGQSVDKVCGVYLD
GRNVYVCPLSGTILFAIYTTLYLGTPRMTWTKLYLTQNMETLNASASLLKQWRPDYCIGS
HLRQMLTYGCTRPEIGVQNTYEDVARDTNRGHTVATVEDCFRLAKDAGFKIVANMMPNLP
NVDMERDMESFREFFENPAFRTDGLKLYLTVVIRGTGLYELYRNYPPERLVDLVARVLAL
VPPWTRVYRIQRDIPMPLVTSRVEKGNLRELSLARMDDLGLKCQDVRTLEVGIQDIHHKI
KSKEVELVRRDYVANEGWETFLSYEDTRQVLKSFLRRYRQKHELRCYIWMMCSVVRELHV
YGTAVPVHGRETDKLQHQDYGSLLTEEAERISFTENWSTKLAVISGVGTRHYYRKLRCEL
EGPYVVRECHLSTFITIAVLKTNEPRRLLSNLM
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacagacatacctcttgcactagagcagcagcagaagaagaagaagccagcg
cctgggcgaggcggtgttacggcgacactcagcgaggatgaagcgctattgcgttgtatt
ggggagattgtggatgcgatggttcaggggtgccggaaaggggagagtgtggacttgaat
gcgctcaaatcggaagcgtgcaaacgttacggtctttctcgggctcccaagctggtggag
ctgattgctgcgttgcctgagtccgagagggagatggtcttgcctaggttgcgagcaaag
ccagtgagaactgcgtcaggaattgcggtgttagctgtgatatcgaagccgcaccgatgc
cctcacattgcaacgacgggaaatattttttatagtactcaattatatactggttacgga
ccaactagtatgcgagcaattagggctaggtataatccttatgttcaagctcgcggccgg
atcgacctgctgaagaggcttggtcagagtgtagataaggtttgtggagtttatcttgat
gggaggaacgtttatgtctgcccgctgtctgggactattttattcgcaatttacactacg
ctctatctgggcacacctcgcatgacgtggacgaagctgtaccttactcagaacatggaa
acgttaaatgcatcggcctcactattgaaacaatggagacctgattactgcattggttca
catttgcgtcagatgttgacgtatggctgcacccgcccagaaattggtgtacaaaacacc
tacgaagatgtggcacgggataccaataggggacacacagttgccactgttgaagattgt
ttccgccttgctaaagatgcaggttttaagattgttgcaaacatgatgccaaatcttccc
aatgtggatatggagagagatatggaaagcttcagggaattttttgagaatcctgcattt
cgcacggatggtcttaagttgtacctcacggtagtgattcggggaactggcctttatgaa
ttgtaccgtaattatccaccagaacggttggtagacttggtagcacgagtgctggccctg
gtaccaccatggactcgtgtatatcggattcaaagagacattcctatgccgcttgtcact
tcacgtgtagaaaaaggtaatttgcgggagttatcattagcacgcatggacgatctagga
ttgaagtgtcaagatgtgcgaaccctagaggtaggaattcaggacatacatcataagatc
aaatctaaggaagtcgagctcgtccgacgagattatgttgcgaatgaaggttgggagacg
tttctatcatacgaagacactcgccaggtccttaaatcatttctacgtagatatcgacag
aaacatgagctgcgctgctacatttggatgatgtgttctgtggtgcgagagcttcatgtt
tatggaactgctgtccctgtccatggtcgagaaactgacaagctgcaacatcaggattat
ggttcgctgctgacggaagaagccgagaggatctctttcacagagaattggtcaacgaag
ttggcagttatttctggtgttggtactcgccattactacagaaagcttagatgtgagttg
gagggtccatacgtggttagagagtgccatctttccacctttattaccattgcagtattg
aagaccaatgagcccagaagattactgtcgaatttgatgtaa

DBGET integrated database retrieval system