KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_91575Help
Entry
PHYPADRAFT_91575  CDS       T01041                                 

Gene name
CHR1543
Definition
SNF2 family DNA-dependent ATPase
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PHYPADRAFT_91575 (CHR1543)
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PHYPADRAFT_91575 (CHR1543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1122 aa AA seqDB search
MRRSAAPSMLAKKLQEQGKENVINAKSAIFEKAGGSEPFRNIIPSRKRFRTPFTSPQAVV
SPRTKLHSAGGTESYGSEGLAICKGSNVVRDAPTAGRKPSQVLQLMQSRRIGTMSNISST
VSDQCDKLSPQSASPLDLYSASDIVEKVAFEEGNSDLFSKADLETIPGNSSSFESSCAVG
AKRDCPEDGELENASLDVRKKHCPAEKEGEPLLSEKGLCVEQAAAISKETVACAYDRLNE
DLKLDLIPSGGADTVNLKENLESTSNKGEGEPYVHVKEDHNDEVVSLSSKPTNPEETLHG
PHRQFSSLHGVNLLEAVNHTHELPTTVHYLVMYCPRKKNAKRKGPWSDGIIVCQGRSCTL
QDMDSKVVSKSNFQGLKDMPEGATLEVGKFEVEVMRKASNEEVLSGTLYMANKLLPSIPI
QCPLKTLKKQPFKSSKLDGSQQSSMTILYLVHVKDAWKLNEDSSTEVPVVVDPYIASKLR
PHQKDGVMFMYECIMGLRSNSFCGCLLADEMGLGKTLQVITLIWTILKQHTLFVLLDLSN
EDVSSVICKRMKLYMTVGVDFHSQGPGGSPAVKRVLVVCPSSLVHNWGNEVHKWLGRERL
RFMAVHAGTAYREAAQKFADFKAGFSSPLLITSYEILRKHIDIIASTKPGLLVCDEAHRL
KNCAGNKTIDALVGLQCPRKILLTGTPVQNDLNEFYAMIDFANPGLLGPLSSFKRIFAEP
IERSQDRTASEEEQKLGQARSLELQSRTEFCILRRTANINEAYLPTKTEVVARKILFKHE
GITGWHHCPMSPKEGSMALRSVYMTENVSATILSSITSLRKLCSHPQLSYNDIIEGTNLD
AELKSQIIAAGLSRFSDSTDNIEVLQSRASLSDEGWKFSGKLACLYWLLRTVYTSRTARQ
KDRVVVVSNFTRTLDLIQDMCTSQGWNWLRLDGSTEASKRQLLVDQLNSGVGDVFVFLLS
SKAGGTGLNLIGANRLVLFDPDWNPATDSQAIARIWREGQLKPVLIYRLLSTGSIEEKIY
QRQIMKGGMSAAVEGDADVHTKKSNIGRHFSKEELKELFTLNLATNCDTFDLISRTKTAP
AKTWMDDSENVDDPALQSAIKSGIVSFVYNDRRPAPQQLATV
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgaggagatcggctgctccaagcatgcttgcaaagaaacttcaggaacaggggaaagag
aatgttattaatgcaaaatctgctatcttcgagaaagctggcggaagtgaaccctttcgg
aacatcataccaagcaggaaaaggttcagaacacctttcacctcaccgcaggcagttgtt
tcccctagaacgaagttgcactctgcaggtggaacagaaagctacggatctgaaggactt
gcaatatgtaagggctctaacgtggttagagatgctcccactgcagggaggaaaccctcc
caggtactccaactgatgcaatctagaagaattgggacgatgagtaacatctcctccact
gtctctgaccagtgtgataaactttcgcctcaatccgcaagtccattggatctctattcc
gcatccgatattgtggagaaagttgcattcgaggaaggaaactccgacttgttttcaaag
gcagatctcgaaacaattcctgggaattcttcgtcgtttgaatcctcttgtgcagttggt
gcgaaacgggattgtcccgaggatggcgagttggaaaacgcaagtttggatgttcggaag
aaacattgtcctgctgagaaagagggagaacctctgttgtcagaaaaaggtttgtgcgtc
gaacaagcagcagcgatctcaaaggaaacagttgcttgtgcgtatgaccgtttaaatgaa
gatctcaagctagatctgataccatcgggcggtgcagatacagttaacttgaaagaaaat
ttggagtccacaagcaataaaggagaaggggagccatatgtccatgtgaaggaagatcac
aatgatgaagtagtgtctctcagttcaaagcctacgaatcctgaagagactttgcacggt
ccccatcgccagttctcatctcttcatggtgtaaatttgctagaggcagtgaatcatacg
cacgagctgccgacaacagtgcattacttggttatgtattgcccgcgcaaaaaaaatgct
aagcgaaaaggtccctggtctgatggtattattgtttgtcaagggcgatcgtgcactctc
caagacatggatagtaaagttgttagtaaatcgaattttcaaggattgaaggatatgcca
gaaggagccactcttgaggtcggaaaatttgaggtagaggtgatgagaaaagcttctaat
gaagaagttctcagtggtactttgtatatggctaacaagcttcttccgtcaattccaatt
cagtgtccattgaagacgttgaagaaacagccgttcaaaagttcaaagctggatggatca
caacagtccagcatgacaattttgtatctggttcatgtgaaggacgcttggaagctgaac
gaggattcatctacagaggttcctgtcgtcgtggatccgtatattgcatcaaagttgagg
ccgcatcaaaaagatggagtgatgttcatgtatgaatgtatcatgggactaagatcgaac
tccttctgcggatgtttgctagctgatgaaatgggtcttggcaagactctgcaagtaatc
accttaatatggacaattttgaagcagcatacacttttcgtcttacttgacctttcaaac
gaagatgtaagttcagtcatttgcaaaaggatgaagttgtacatgactgttggagttgac
tttcattcgcagggtcctggcggttctccagctgtcaagcgtgtcctggtcgtttgcccc
tcgtctcttgttcataactgggggaacgaggttcacaaatggcttgggagggagagattg
aggtttatggcggtacatgcaggaactgcgtacagggaggctgctcagaaatttgcagat
tttaaagctggattctccagtccgctcttgataacatcctacgaaattctacggaaacac
atcgacataattgcatccaccaaaccggggctactggtttgtgatgaggctcatcgcctc
aagaactgtgctggtaacaagaccattgatgctctcgttgggcttcaatgccctcgtaaa
attcttctgaccggaactcctgtccagaacgatctaaacgagttttatgctatgattgac
tttgccaatccagggcttttaggccctctttcttcgtttaagcggatattcgcagagcct
attgagcgaagtcaggatcgcactgcaagtgaagaggagcaaaagttgggacaagccaga
tcccttgaacttcaatcgagaactgaattctgcattcttcggaggacagcaaacataaac
gaagcatacttacctaccaaaacagaggtagtagccagaaagattcttttcaaacatgaa
ggaatcactggctggcatcattgtcctatgtcgcctaaagaaggatcaatggcacttagg
tcggtgtacatgaccgaaaatgtttcagctacgatcttatcctcaataacctctttgagg
aagttgtgtagccaccctcaacttagttacaacgatatcattgaaggcacaaacctggat
gcggagctaaaatctcagataattgctgctggattaagcagatttagtgacagtacagat
aacattgaagtcctccaatcaagggcgagcctgtcagatgaaggatggaagttttctggg
aaattggcatgtttatattggctcctccggacagtttacacaagccgtacagctaggcaa
aaggatagggtggtggtggtttccaattttactcgaacattggacttaattcaggatatg
tgcacgagtcagggttggaattggttacgactggacggttcgacggaagcatctaaacgg
caactactcgttgatcaattaaacagtggcgttggagatgtgtttgtgttccttctgtca
tcaaaggctggtggaactggtcttaacctgatcggggccaataggcttgtactgtttgat
cctgactggaatccagctaccgactcccaggcgattgctcgtatatggagagaagggcag
ctaaaaccagtcctgatatacaggcttctgtcgactggcagcatcgaagaaaaaatctat
cagcgtcagataatgaaaggaggaatgtctgcagctgtggaaggagatgcggatgtccat
accaaaaagagcaacataggtcgtcatttttccaaggaagagctcaaagagcttttcaca
ttaaatctggcgacaaattgcgacactttcgacctcatctccaggacaaaaacggctcct
gccaagacctggatggatgattcagaaaacgttgacgatcctgcgcttcagagtgctatc
aagtcaggaatcgtgtcattcgtgtacaacgacagacgtccagcaccacagcaactcgca
acagtctga

DBGET integrated database retrieval system