KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_98257Help
Entry
PHYPADRAFT_98257  CDS       T01041                                 

Gene name
CHLH2
Definition
CHLH2 like Mg protoporphyrin IX chelatase subunit H protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1332 aa AA seqDB search
MGGGGMFTQTRPEVRRIVPASRPGVPVVKVVYVVLEAQYQSSLSAAVRNINRTRKEVQIE
VVGYLVEELRDAENFETFKKDVGEANVFIGSLIFVEELAQKVKEVVEANRDRMDAVVIFP
SMPEVMRLNKLGTFSMSQLGQSKSAIAQFMRRKRKENVGNFEEGMLKLIRTLPKVLKYLP
SDKAQDARNFMMSLQFWLGGSPENLENFLVMISNAYVPALTGQKLEYDDPVVSLDTGIWH
PMAPQMYDDIKEYLNWYGTRRDANEALKDPKAPVVGIVLQRSHIVTGDHGHYDAVVMEME
ARGAKVVPIFAGGLDFSGPVERFFYDPITKKSLVQSVVSLTGFALVGGPASQDHPKAIEA
LKKLDVPYLVALPLVFQTTEEWLGSTLGLHPIQVALQVALPELDGGLEPIVFSGRDSRTG
KSHALHDRVDQLCTRAIKWANLKRLAKAEKKLAITVFSFPPDKGNVGTAAYLNVFSSIYS
VLKELKADGYNVEGLPESSEALIEEVIHDKEARFSSPDLNIAYKMPTREYYQLTPYAKAL
EESWGKAPGTLNSDGQNLLVYGKQFGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAY
YTFLEKIFKADAVLHFGTHGSLEFMPGKQVGMSDICYPDSLIGNIPNIYYYAANNPSEAT
IAKRRSYANTISYLTPPAENAGLYKGLKQLSELISSYQSLKDSGRGAQIVSSIISTARQC
NLDKDVELPGEEAELSADERDTVVGRVYGKLMEIESRLLPCGLHVIGEPPSAEEAVATLV
NIAAIDRPEEDIAGLPGLLAQAVGREIEDVYRSSDRGVLADVTLLNEITQTSREVVGAFV
AKTTNKAGQVVNVQNGLANLFGFAKKDPWMDALQNTKFRNVDQAKMTTLFEFLAFCLKQV
VADNELGGLKEALEGRFVEPGPGGDPIRNPNVLPTGKNIHALDPQAIPTAAALASAKIVV
DRLLERQKIENGGKYPETIALVLWGTDNIKTYGESLAQVLWMVGVRPVPDSLGRVNKIEP
VSLEELGRPRIDVVVNCSGVFRDLFINQMNLLDRAVKTVAELDEPVEMNFVRKHALEQVE
TLGVSLREAATRIYSNASGSYSSNVNLAVENSSWNDEKQLQDMYLSRKSFAFDSDAPGAG
MSEKRQIFESALATADATFQNLDSSEISLTDVSHYFDSDPTKLVQSLRPDKKAPASYIAD
TTTANAQVRSLAETVRLDARTKMLNPKWYEGMLSSGYEGVREIEKRLTNTMGWSATSGTV
DNWVYEEANNTFINDEEMQKRLLETNPNSFRKLVSTFLEANGRGYWETSEDNLEKLRQLY
QDVEDRIEGIDK
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtggcggcatgttcacccagacgaggccagaggtgagacgcattgtccctgcg
tccaggccgggagtgccggtggtgaaggtggtgtatgtggtgctggaagcgcagtaccaa
tcctccctttcagccgccgtgaggaatatcaacaggacccgcaaggaggtgcagatcgag
gttgtggggtatcttgttgaggagctgcgtgacgcagagaacttcgagacgttcaagaag
gatgttggcgaagcgaacgtcttcattggatcattgatattcgtggaggagttggcccag
aaggtgaaggaggtagtggaagccaacagggacaggatggacgcggtggtgatattcccg
tccatgccagaggtgatgaggttgaacaaattgggcacattctccatgtctcagctgggg
caatcgaagagtgcgattgcccagttcatgaggaggaagaggaaggagaatgtagggaac
ttcgaggagggcatgttgaaactcatccgcacgctgccgaaggtgttgaagtacctgccg
agcgacaaggctcaagatgcgcggaacttcatgatgagtttgcagttctggctgggaggc
tctcccgagaacctggagaactttttggtgatgatatcgaacgcgtacgtcccggcattg
acgggccagaagttggagtatgacgaccctgtggtgtccctggacacgggcatctggcac
ccgatggcccctcagatgtacgacgacattaaggagtatttgaattggtatggaacccga
cgcgatgccaacgaggccctgaaggacccgaaggcgccggtggtggggattgtgttgcag
cgaagccacatcgtgactggtgatcacggtcactatgacgccgtggtcatggagatggag
gcgcggggtgcgaaggtggtgccaatttttgcaggtggcctggacttctctggacccgtg
gagcgattcttctacgacccgatcacgaagaagtcattggttcagtcggtggtttctctg
actggatttgctctcgtgggtggacccgcaagccaggatcatcctaaggccattgaagct
ttgaaaaagctggatgtgccgtatttggtcgcacttcctttggtattccagacgaccgag
gaatggctgggcagcactttgggactgcaccctattcaggttgccctccaagttgcccta
cctgagttggacggaggtttggagccaatcgtgttctccgggcgtgatagtcgcacaggc
aagtcccatgcgctccacgaccgcgtggaccagctgtgcactcgggccatcaagtgggct
aacctgaagcggctggcgaaggcggagaagaagttggcgatcacggtgttcagcttcccc
cctgacaagggaaatgtcgggaccgccgcgtatctgaacgtgttctcgtccatttatagt
gtgttgaaggagttgaaggctgacgggtacaacgtggaggggctccccgagtcatcggag
gcactcatagaggaggtgattcacgacaaggaagctcggttcagcagccccgacctgaat
atcgcgtacaagatgccgacacgggagtactatcagctgactccttatgcgaaggcactg
gaggagagctggggcaaggccccggggactctgaactcagacgggcaaaacctgctggtg
tatggaaagcagtttgggaacgtgttcatcggtgtccagcctacgttcggatatgaggga
gatccgatgcgtcttctgttttcgaagtcggcgagccctcaccacgggtttgccgcgtac
tacacatttttggagaagatcttcaaggcggatgctgttctgcactttggaactcacgga
tcactggagtttatgcccggaaagcaggtgggcatgagcgacatctgttaccccgacagc
ttgatcgggaacatccccaacatctactattatgctgcgaacaacccgtcagaagctacg
attgcgaagaggcgtagctatgccaacaccatcagctacctgacaccccctgccgagaat
gctggtctgtacaagggactgaagcagctgagcgagctgatctcatcttaccagtcattg
aaggactctgggcgtggtgcgcagatcgtgtcgagtattatcagcactgcgaggcagtgt
aacctggacaaggacgtggaactgcctggcgaggaggcggagctgtcagccgacgagagg
gacaccgtggtaggtagggtgtacggaaagctcatggagatcgagtcgaggctgctgcct
tgcgggctgcacgtgatcggagagcctccgagtgccgaggaggcggtggcaacgcttgtg
aacattgctgccatcgacagaccggaggaggacatcgctgggttgccagggctgttggct
caggccgtggggcgtgagattgaggacgtctacaggagtagtgatcggggtgtgcttgcc
gacgtgactctgctgaacgagatcacacagacgagccgtgaagtggtgggtgcgttcgtg
gcgaagacgacgaacaaagccggtcaggtggttaacgtgcagaatggtctggccaacctc
tttggtttcgcaaagaaggatccatggatggatgctctgcagaacacgaaattcaggaac
gtggatcaggcgaagatgaccactctgttcgagtttttggcattctgcttgaagcaggtg
gtagcggacaatgagctaggcggtttgaaggaagcgttggaagggagattcgtggagcct
ggcccaggaggagacccgatcaggaacccgaacgtactgccaacggggaagaacatccac
gctttggacccccaggccattccgacggctgcggctttagcgagcgcgaagatcgtcgta
gatcgtctgctggagcgtcagaagatagagaatggtggcaagtatccggagacgatcgca
ttggtgttgtggggtacggacaacatcaagacgtatggggagtctcttgcccaggtgttg
tggatggtgggtgttcggccagtgcccgattcgttggggcgtgtgaacaagatcgagcca
gtgtctctggaggagcttggacgacctcgcattgacgtggtggtgaactgctcgggcgtg
ttcagggacctgttcatcaaccagatgaacttgctggacagagcagtgaagactgtggca
gagctggatgagcctgtggaaatgaactttgtgcgcaagcacgcgttggagcaggtggag
accctaggggtgtcgttgcgggaggctgcgactcgaatctactcgaacgcctcagggtcg
tactcctcgaacgtcaacctggcggtggagaactcatcgtggaacgatgaaaagcaactg
caggacatgtatttgtcacggaagtcgtttgcttttgacagcgatgctcccggtgctgga
atgagcgagaagaggcagatcttcgagtctgctctagcaacagcagacgcgacgttccag
aacctggactcttcggagatttcgttgacggatgtgagccactacttcgactcggacccg
acgaagctcgtacagagtttgaggccggacaagaaggcaccagcttcgtacattgcggat
acgacgactgcaaacgcgcaggtgcggtctttggcggaaacggtgaggctggatgcccgg
acgaagatgctgaacccgaagtggtacgaggggatgctgtcgagcggttacgagggtgtt
cgtgagatcgagaagaggctgacaaacacgatgggttggagtgcaacttctggcacggtg
gacaactgggtgtacgaggaagcgaacaacaccttcattaacgacgaggagatgcagaag
aggttgttggagacgaaccccaactcgttcaggaagctggtgtcgacgtttttggaagcg
aatgggcgcggctactgggagacttctgaggacaatctggagaagttgaggcagttatac
caggacgtggaagacaggatcgagggcattgacaagtag

DBGET integrated database retrieval system