KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_99786Help
Entry
PHYPADRAFT_99786  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_99786
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_99786
   00620 Pyruvate metabolism
    PHYPADRAFT_99786
   00640 Propanoate metabolism
    PHYPADRAFT_99786
Enzymes [BR:ppp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PHYPADRAFT_99786
Lipid biosynthesis proteins [BR:ppp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PHYPADRAFT_99786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 634 aa AA seqDB search
MYKRSVENPDGFWGDIASTFFWKKRWPVKDGKVHTENIDVRNGRVAVEWFKGGQTNICYN
AIDRHVEAGLGDKVAFYWEGNDLGVDASLTYKEVLEKVCQLANYLRSQGVKKGDAVAIYM
PMLAELPIAMLACARIGAVHSVVFAGFSAESLYQRILDCKPNVILTSSAVKRGAKIIKLK
DIVDDALSRASADGHTVGMCLTYDNSSALKREETAWTEGRDSWWQDIVPSYAKECDVEWV
DAEDTLFLLYTSGSTGKPKGVLHTTGGYMVYAATTFKYAFNYHDDDVYWCTADCGWITGH
SYLTYGPLLNGASMVVFEGVPNYPDAGRCWDIVDKYNVSIFYTAPTAIRSLMRSGDEPVL
RHSRKSLRVLGTVGEPINPSAWKWYHEVVGDKLCPIVDTWWQTETGGFMITPQPGAWALK
PGSATLPFFGVQPAVVDDNAQEQSGECSGYLCIKAAWPGMMRTLQGDHDRYETTYFAPFK
GFYFSGDGCRRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGFDHE
VKGQGIYAFVTLLEGVEYSNDLRKALINSVRSQIGAFAAPDVVHWAPGLPKTRSGKIMRR
ILRKIASNELDQVGDISTLADSSVVDQLISLRNK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagcgatctgtggagaaccccgatggcttctggggtgacattgcatcgacattt
ttctggaagaagagatggcccgtcaaggatggcaaagtgcataccgagaatattgatgtt
cgcaacgggcgcgttgctgttgagtggttcaagggtggacaaaccaacatctgttacaat
gccatcgacaggcatgtagaagcaggcctcggtgacaaggttgctttctactgggaaggt
aacgacctcggtgtggatgcttctctgacatacaaggaagtactggaaaaagtttgccag
cttgcaaactatttgcgtagtcaaggtgtgaagaaaggcgacgcagtggcaatctacatg
cctatgctggcagaactgccaatcgccatgcttgcctgtgctcgaattggagctgttcat
tctgttgtctttgccggattctccgcagaatctttatatcagcgtattctggattgcaag
ccaaacgttattttgacgagcagtgcggtgaaacgtggcgccaagattatcaaactcaag
gatattgttgatgatgcattatcacgtgcatcagcggatggtcacactgtaggtatgtgc
ctgacatatgacaatagttctgcattgaagagagaggagaccgcgtggacagaaggccgt
gattcgtggtggcaggatatcgtgccatcatatgcaaaagaatgtgatgtggagtgggtt
gacgcagaagatacgctgtttttgttatacaccagtggaagcactgggaagcccaagggc
gtgctgcatacaacaggaggttacatggtatatgcggctacaaccttcaagtatgcattt
aattaccacgatgatgacgtctactggtgcacagcagactgtgggtggattactggtcac
agctacctgacatatggccctcttctcaacggtgctagcatggttgtctttgaaggggtc
cccaactatccagatgcaggtcgctgctgggacatagtagacaaatataacgtttccatc
ttctatactgccccaactgcaattcgttcattgatgcggtcgggtgacgagcccgtttta
cggcactctcgtaagtcactgcgagtgcttgggactgtgggagagccgatcaatcccagt
gcgtggaagtggtaccatgaagtcgttggcgacaaactctgccctatagttgatacatgg
tggcaaacagagacggggggtttcatgattaccccgcaaccaggcgcttgggctcttaaa
cctggatctgctaccttacccttctttggtgtccagcctgctgtagtagacgataatgct
caagaacagtctggagaatgtagtggttacttgtgtatcaaggcggcctggcctggcatg
atgagaactctacaaggagaccacgaccgatatgaaaccacatattttgctccttttaaa
ggattctacttcagtggtgatggatgccgcagagataaagatggttactattggttgaca
ggacgagtcgacgatgtcatcaatgttagtgggcaccgcattggtacagccgaggtagag
tctgctcttgtttcgcatccccagtgcgctgaagcggcagttgttgggttcgatcacgag
gtgaaaggtcaaggtatttacgcatttgtgacacttctagaaggcgtagagtacagcaat
gatcttcgcaaagctctcatcaactccgttagatcacagattggagcgttcgcagcacct
gatgtagtccattgggctccaggactgcccaagacaaggagtgggaaaatcatgcgcaga
atattgcgaaagattgcgagcaacgaattggatcaagtgggggatatcagcaccttggca
gattccagcgtggttgatcagctcataagtctccgaaacaagtaa

DBGET integrated database retrieval system