KEGG   Photobacterium profundum: PBPRA0123Help
Entry
PBPRA0123         CDS       T00173                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppr  Photobacterium profundum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PBPRA0123
Enzymes [BR:ppr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PBPRA0123
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PBPRA0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:125675..126727
Genome map
AA seq 350 aa AA seqDB search
MSVSIQGAFPARRMRRMRKHDFSRRLMAENQISVNDLIYPMFILMGKDRRETVESMPGIE
RLSIDLMLQEAEYLAKLGVPAIALFPVVSQDFKSICAAEAHNPEGLVQRAVRLLKEHVPQ
MGVITDVALDPFTTHGQDGIIDEDGYVINDVTTEVLIKQALSHAEAGADVIAPSDMMDGR
IGAIREALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSSSNLKGGDKKTYQMDPANSDE
ALHEVAMDVNEGADMVMVKPGMPYLDVVRRVKTELKVPTFAYQVSGEYAMHMAAIQNGWL
KERETVMESLMCFKRAGADGVLTYFAKSVAEWLAEDAAARKTDADSCSQK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtatctattcaaggcgctttcccggcacgccgtatgcgtcgtatgcgtaagcat
gactttagccgtcgtttaatggctgaaaaccaaatatctgttaacgatctgatttaccct
atgttcattctgatgggtaaagatcgtcgtgaaacggtagagtcaatgccgggcatcgaa
cgactgtctatcgaccttatgttacaagaagctgaataccttgcgaaattaggtgtgcca
gcaattgcgttattcccggttgtttctcaagattttaagagcatttgtgccgcagaagct
cacaaccctgaaggcttagtacagcgtgcggtgcgcttgctaaaagaacatgtgcctcaa
atgggcgtgatcactgatgttgcccttgacccatttaccacacacggtcaagacggcatt
attgatgaagacggttacgtaattaacgatgtgacaacagaagtactgatcaagcaagct
ttgtcacatgctgaagcgggtgctgatgtgatagcaccgtcagatatgatggatggtcgc
attggcgcgatccgtgaggcattggaagaagcgggttacattcacacccagatcatggcg
tattctgcgaaatacgcgtctaactattatggccctttccgtgacgccgtcggttcgtcg
agcaaccttaaaggcggcgataagaaaacgtatcaaatggatcctgcgaattctgatgaa
gccctacatgaagtcgcaatggacgtgaatgaaggcgctgatatggtaatggtgaaacca
ggtatgccgtaccttgatgttgttcgtcgcgtgaaaacagagctgaaagtaccgacgttt
gcttatcaagtatcgggtgaatacgcgatgcacatggctgcaattcaaaatggttggctg
aaagagcgtgaaaccgtgatggaatcactgatgtgctttaagcgcgcaggggctgatggt
gtactaacgtactttgctaaatcggttgcggaatggttagcggaagatgctgcagcacgt
aaaaccgatgctgatagctgttctcagaaataa

DBGET integrated database retrieval system