KEGG   Photobacterium profundum: PBPRA0234Help
Entry
PBPRA0234         CDS       T00173                                 

Gene name
PFKA
Definition
(GenBank) putative 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppr  Photobacterium profundum
Pathway
ppr00010  Glycolysis / Gluconeogenesis
ppr00030  Pentose phosphate pathway
ppr00051  Fructose and mannose metabolism
ppr00052  Galactose metabolism
ppr00680  Methane metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
ppr01200  Carbon metabolism
ppr01230  Biosynthesis of amino acids
ppr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA0234 (PFKA)
   00030 Pentose phosphate pathway
    PBPRA0234 (PFKA)
   00051 Fructose and mannose metabolism
    PBPRA0234 (PFKA)
   00052 Galactose metabolism
    PBPRA0234 (PFKA)
  Energy metabolism
   00680 Methane metabolism
    PBPRA0234 (PFKA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PBPRA0234 (PFKA)
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PBPRA0234 (PFKA)
Protein phosphatases and associated proteins [BR:ppr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PBPRA0234 (PFKA)
Messenger RNA biogenesis [BR:ppr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PBPRA0234 (PFKA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAG18673
UniProt: Q6LVK2
Position
1:240156..241118
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAVRGVVRAALSDGLEVYGIYDGYQGLHQNRIEKLSRTSVSD
VINRGGTFLGSARFPEFKDEKVRAQAIQNLKMHGIEALVVIGGDGSYMGAKKLTEMGFPC
IGIPGTIDNDVAGTDYTIGYFTALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLM
SAIAGGCEYIITPETGLHKEELIAKIKEGIYKGKKHAIVALTELMTDANELAKYIEDETG
RETRATVLGHIQRGGQPTAFDRILASRMGAYAVELLIQGEGGRCVGVQNEKMVHHDIIDA
IENMKRPVRKDLYELADKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagattggtgttttgaccagtggtggtgacgcacctggtatgaatgcagcg
gttcgcggtgttgtacgtgctgcgttatcagacggtctagaagtgtacggaatatatgac
ggctaccaaggtcttcatcagaaccgtatcgaaaagctaagccgcacaagtgtatcagac
gtgattaacaggggcggtacgttccttggttctgcacgtttccctgagttcaaagacgaa
aaagttcgtgctcaggcgattcagaacttgaagatgcacggcatcgaggcacttgttgtt
atcggtggtgacggttcatacatgggtgctaagaagctaactgagatgggcttcccatgt
atcggtattccaggtacgattgataatgatgtagcaggtactgattacacgattggttac
tttactgctttaaatacggttattgatgcgattgaccgtcttcgtgatacgtcttcttcc
caccagcgtatttctatcgttgaagttatgggccgccattgtggtgatcttactttaatg
tcagcaattgctggtggctgtgaatacatcattacgcctgaaactggtcttcataaagaa
gagctgatcgctaagattaaagaaggtatctacaaaggcaagaagcacgcgattgtggcg
cttacagagctgatgacagatgctaacgaactagcaaaatacatcgaagatgaaaccggc
cgtgaaacacgcgcgacggtgctgggtcacattcaacgtggcggtcagccgacggcattt
gaccgtattcttgcatcacgcatgggtgcttacgcggttgagctgcttatacagggtgaa
ggtggtcgttgtgttggtgttcagaatgagaagatggttcatcacgatatcatcgacgcc
attgagaacatgaagcgtcctgttcgtaaagatctttacgagctagcagacaaattgttc
taa

DBGET integrated database retrieval system