KEGG   Photobacterium profundum: PBPRA0235Help
Entry
PBPRA0235         CDS       T00173                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppr  Photobacterium profundum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA0235 (tpiA)
   01230 Biosynthesis of amino acids
    PBPRA0235 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA0235 (tpiA)
   00051 Fructose and mannose metabolism
    PBPRA0235 (tpiA)
   00562 Inositol phosphate metabolism
    PBPRA0235 (tpiA)
Enzymes [BR:ppr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PBPRA0235 (tpiA)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PBPRA0235 (tpiA)
  Exosomal proteins of bladder cancer cells
   PBPRA0235 (tpiA)
  Exosomal proteins of melanoma cells
   PBPRA0235 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(241320..242108)
Genome map
AA seq 262 aa AA seqDB search
MIWRKTMRHPVVMGNWKLNGSKEMVVNLLNGLNAELEGVTGVDVAVAPPALFIDLAEHTL
TEAGSAIILGAQNSDLNNSGAFTGDMSPAMLKEFGASHIIIGHSERREYHNESDEFVAKK
FAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAI
GTGKAATAEDAQRIHAQIRAHIAEKSEEVAKNLVIQYGGSVKPENAAAYFAQPDIDGALV
GGAALDAKSFAAIAKAAAEAKA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatttggagaaaaactatgcgtcatcctgtagttatgggtaactggaaactaaacggc
agcaaagaaatggttgttaatctactaaacggtcttaacgctgaacttgaaggcgtaaca
ggcgttgacgtagcagttgctccaccagcacttttcatcgatcttgctgagcatacgctt
actgaagctggcagcgcgatcatcctaggtgctcaaaactcagatctaaataacagcggt
gcattcactggcgatatgtctccagcaatgcttaaagagttcggcgcatctcatatcatc
atcggtcactctgagcgtcgtgaataccacaacgaatcagacgagtttgttgctaagaaa
ttcgcattcctaaaagaaaacggcctaacgcctgttctttgtatcggcgaatctgacgct
caaaacgaagctggcgaaacaatggcagtttgtgcacgtcaacttgacgctgttatcaac
actcaaggtgttgaagctcttgaaggcgctatcatcgcttacgaaccaatatgggctatc
ggtactggtaaagcagctacagctgaagatgcacaacgcatccacgctcaaatccgtgct
cacattgcagagaaatctgaagaagttgctaagaaccttgttattcaatacggcggttct
gttaagccagaaaacgcagcagcatactttgcacaaccagacatcgatggtgctctagtt
ggcggtgcagcacttgacgcgaaaagctttgccgctatcgctaaagcagcagctgaagca
aaagcgtaa

DBGET integrated database retrieval system