KEGG   Photobacterium profundum: PBPRA0457Help
Entry
PBPRA0457         CDS       T00173                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ppr  Photobacterium profundum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PBPRA0457
   00051 Fructose and mannose metabolism
    PBPRA0457
Enzymes [BR:ppr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PBPRA0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(477500..478819)
Genome map
AA seq 439 aa AA seqDB search
MTEFFKNINKIQFEGTDAINPLAFRHYDAERMILGKSMKEHLRFAACYWHNFCWPGSDVF
GAATFDRPWLQSGNAMEMAHMKADAAFDFFSKLGVPYYCFHDTDIAPEGTSLKEYVNNFA
QMVDVLEQKQDETGLKLLWGTANAFSNPRYMSGAGTNPDPKVFAYAATQIFNAMGATQRL
GGENYVLWGGREGYETLLNTDLRQEREQLGRLMQMVVEHKHKIGFKGTILIEPKPQEPTK
HQYDYDTATVYGFLKQFGLENEIKVNIEANHATLAGHSFQHEIATATSLGLFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGFNFDSHVRRPSIDAEDLFYGHIGGM
DTMALALERAANMIENDVLSKNIAQRYAGWNEDLGKKILSGDHSLETLAKFALDSNIAPV
KESGRQEHLENIVNGFIYK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattttttaaaaacattaataaaatccaattcgaaggcacagacgcaattaac
ccattagccttccgtcactatgatgctgaacgtatgatcctcggcaagtcgatgaaagaa
caccttcgctttgcagcatgttactggcataacttctgctggccaggttccgatgtattt
ggtgctgcgacatttgaccgaccttggttgcaaagtggcaatgcaatggagatggcacat
atgaaagccgatgccgccttcgattttttctctaagctgggcgtaccttactactgcttc
cacgataccgacattgctcctgaaggtacttcgctcaaagagtacgtgaataacttcgct
caaatggtagatgtactggaacaaaaacaagatgaaaccggattaaagttgttatggggt
actgccaacgccttctctaatcctcgctatatgtcaggcgctggaaccaacccagatcca
aaagtttttgcttatgccgcaacgcaaattttcaatgccatgggcgcaacacaacgtctg
ggcggtgaaaactacgtgttatggggagggcgagaaggctatgaaacactcttaaatacc
gatctacgccaagagcgcgaacaacttggtcgcctcatgcaaatggttgttgagcacaaa
cataagattggtttcaaaggcacaattctgattgaaccaaaaccacaagaaccaaccaaa
catcaatacgattacgatactgcaacggtttacggtttcttgaagcaatttggcttagaa
aatgaaatcaaagtcaatattgaagcaaatcacgccacactggctggtcatagcttccaa
catgaaatcgcgaccgcgacctcactgggcctgttcggttcaatcgatgccaaccgtggt
gatccacaattgggttgggatactgatcagttccctaacagtgtggaagaaaataccttg
gtcatgtacgaaattttaaaagctggtggctttacaacgggaggattcaactttgattca
cacgttcgtcgcccatccattgatgctgaagatctgttctatggtcacattggcggtatg
gacacaatggcactggctttagagcgcgctgcaaacatgattgagaacgatgtactttct
aagaatattgcccaacgttatgctggctggaatgaagacttgggtaagaagatcttatca
ggcgatcactctcttgaaaccttggcaaaatttgcactcgatagcaacattgcccccgtt
aaagagtctggccgtcaagaacatctagaaaatattgttaacggatttatttataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system