KEGG   Photobacterium profundum: PBPRA0459Help
Entry
PBPRA0459         CDS       T00173                                 

Gene name
GALM
Definition
(GenBank) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ppr  Photobacterium profundum
Pathway
ppr00010  Glycolysis / Gluconeogenesis
ppr00052  Galactose metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
Module
ppr_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA0459 (GALM)
   00052 Galactose metabolism
    PBPRA0459 (GALM)
Enzymes [BR:ppr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PBPRA0459 (GALM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAG18890
UniProt: Q6LUY5
Position
1:480635..481660
Genome map
AA seq 341 aa AA seqDB search
MQAGNCVAWGQYQLIRISNSNNVMIDIATLGATIVNFYVTDKRGCERNIVLGYDDAEGYV
CGDKYIGAVVGPWANRIEKGQYKIEGEQPCQLEQNEKTNHLHGGSAGVHTKAWQVKCVAQ
QGVTLTTRVEAGEAGYPYSIAIEVTYRLSESNELSIQYQAFCEGIVPINLTQHSYFNLNG
DRSDITDHCLSLEADEVLIVDACGIPTASVLVDKNIMDLRTPVRLDHVLDQHAPSLSKLD
GYDHCFVIKGQGLRTAAWLFSSATGIELEMLTDQAGVQFYTGIHLGSTLGRHHQVYSKYS
GLCLEAQHFPNQPNMADKQLECLYGPERMYKQTTVYRVNVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgggaaattgtgttgcttgggggcagtaccaactgattagaatatcgaatagt
aataatgtgatgatcgacattgccacgttaggggcaacgattgtgaatttttacgttaca
gataaacgcggatgtgagcgtaacattgtattgggttatgacgatgctgaaggatatgtc
tgcggtgataaatatattggggcagttgttggaccttgggcgaaccgaatagagaaaggg
caatataaaatagaaggggaacaaccgtgtcagcttgaacaaaatgaaaagaccaaccat
ttgcacggtggttcggcaggggttcataccaaagcatggcaagtgaaatgtgtcgctcag
caaggggtaacgttaacgactcgcgtagaagcaggcgaggctggttacccttatagcata
gccattgaagtgacataccgattgagtgaaagtaatgaactcagcattcaatatcaggct
ttttgtgagggtattgttccgatcaatctaactcaacattcgtattttaaccttaacggg
gataggagtgatataacggatcattgtctgtcgcttgaggccgatgaagtgcttattgtc
gatgcatgtgggattccaaccgcgtcagtattggttgataaaaatatcatggatttacgt
acgccagtgcggctagatcatgtattggatcaacacgcaccatcactatccaagttagac
ggatatgatcattgtttcgtgattaaggggcaaggtttacggacggctgcgtggctattt
tcaagtgcaacgggtattgaacttgagatgctaacggatcaagctggcgtacagttttat
actggcatccatttaggatcgactttagggcggcatcatcaagtgtatagcaagtattca
ggcttatgtttagaagcgcagcattttcccaatcaacccaacatggccgataagcagcta
gaatgcctgtatggaccagagcgaatgtataaacaaacaaccgtttatcgagtgaatgtg
atctaa

DBGET integrated database retrieval system