KEGG   Photobacterium profundum: PBPRA0459Help
Entry
PBPRA0459         CDS       T00173                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ppr  Photobacterium profundum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:480635..481660
Genome map
AA seq 341 aa AA seqDB search
MQAGNCVAWGQYQLIRISNSNNVMIDIATLGATIVNFYVTDKRGCERNIVLGYDDAEGYV
CGDKYIGAVVGPWANRIEKGQYKIEGEQPCQLEQNEKTNHLHGGSAGVHTKAWQVKCVAQ
QGVTLTTRVEAGEAGYPYSIAIEVTYRLSESNELSIQYQAFCEGIVPINLTQHSYFNLNG
DRSDITDHCLSLEADEVLIVDACGIPTASVLVDKNIMDLRTPVRLDHVLDQHAPSLSKLD
GYDHCFVIKGQGLRTAAWLFSSATGIELEMLTDQAGVQFYTGIHLGSTLGRHHQVYSKYS
GLCLEAQHFPNQPNMADKQLECLYGPERMYKQTTVYRVNVI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgggaaattgtgttgcttgggggcagtaccaactgattagaatatcgaatagt
aataatgtgatgatcgacattgccacgttaggggcaacgattgtgaatttttacgttaca
gataaacgcggatgtgagcgtaacattgtattgggttatgacgatgctgaaggatatgtc
tgcggtgataaatatattggggcagttgttggaccttgggcgaaccgaatagagaaaggg
caatataaaatagaaggggaacaaccgtgtcagcttgaacaaaatgaaaagaccaaccat
ttgcacggtggttcggcaggggttcataccaaagcatggcaagtgaaatgtgtcgctcag
caaggggtaacgttaacgactcgcgtagaagcaggcgaggctggttacccttatagcata
gccattgaagtgacataccgattgagtgaaagtaatgaactcagcattcaatatcaggct
ttttgtgagggtattgttccgatcaatctaactcaacattcgtattttaaccttaacggg
gataggagtgatataacggatcattgtctgtcgcttgaggccgatgaagtgcttattgtc
gatgcatgtgggattccaaccgcgtcagtattggttgataaaaatatcatggatttacgt
acgccagtgcggctagatcatgtattggatcaacacgcaccatcactatccaagttagac
ggatatgatcattgtttcgtgattaaggggcaaggtttacggacggctgcgtggctattt
tcaagtgcaacgggtattgaacttgagatgctaacggatcaagctggcgtacagttttat
actggcatccatttaggatcgactttagggcggcatcatcaagtgtatagcaagtattca
ggcttatgtttagaagcgcagcattttcccaatcaacccaacatggccgataagcagcta
gaatgcctgtatggaccagagcgaatgtataaacaaacaaccgtttatcgagtgaatgtg
atctaa

DBGET integrated database retrieval system