KEGG   Photobacterium profundum: PBPRA0567Help
Entry
PBPRA0567         CDS       T00173                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PBPRA0567
Secretion system [BR:ppr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PBPRA0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:616624..617346
Genome map
AA seq 240 aa AA seqDB search
MHFFGRTLLATVVALTAFSAAAKPDEAAIKTKLGALGLAPSSISPSPISGMNEAVTERGV
VYVSDDGNYFIAGHLYQNTGAEPVNLTEQKMAKINKDKLQGMEDEMIIYPAKDEKYVVTV
FTDTTCGYCRKLHGEMQAYNDAGITIRYLAFPRGGERSGNFGQMSAIWGAKDKAKAMNDA
KSGMFDDSGIKLREDLVRKHYELGVAMGVSGTPALILEDGTMLPGYQPAPMLRKMLDSRS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcacttttttggccgaacattacttgcgactgtggttgcgttaactgctttttctgca
gcagcaaagcccgacgaggctgcaattaaaacgaaattgggtgcgctaggtttagctcca
agctcgatttctccttctcctatttcaggtatgaatgaagcggtgactgagcgtggcgtt
gtttacgtatctgatgacggcaattactttattgcaggccatctgtatcagaatacgggt
gccgagccagtgaatctaaccgaacaaaaaatggcgaagattaacaaagacaagctgcaa
ggcatggaagatgaaatgatcatctatcctgcgaaagacgaaaaatatgtcgtgactgtt
tttaccgatactacatgtggttattgccgtaagttacatggtgaaatgcaagcatacaat
gatgcgggtatcaccattcgttaccttgctttcccacgtggtggcgagcgttctggtaac
ttcgggcaaatgagtgctatttggggcgcgaaagataaagcaaaagcaatgaatgatgca
aagagtggcatgtttgacgacagcggtatcaaattacgtgaagatcttgtacgtaagcat
tatgaattaggtgttgccatgggtgttagcggtacgcctgcactaatcttggaagatggc
acaatgcttcctggttatcagcctgcacctatgctgcgtaaaatgctcgatagccgtagc
taa

DBGET integrated database retrieval system