KEGG   Photobacterium profundum: PBPRA0623Help
Entry
PBPRA0623         CDS       T00173                                 

Gene name
VV2687
Definition
(GenBank) Putative DNA polymerase III, psi subunit
  KO
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ppr  Photobacterium profundum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PBPRA0623 (VV2687)
   00240 Pyrimidine metabolism
    PBPRA0623 (VV2687)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PBPRA0623 (VV2687)
   03430 Mismatch repair
    PBPRA0623 (VV2687)
   03440 Homologous recombination
    PBPRA0623 (VV2687)
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PBPRA0623 (VV2687)
DNA replication proteins [BR:ppr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PBPRA0623 (VV2687)
DNA repair and recombination proteins [BR:ppr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PBPRA0623 (VV2687)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:681363..681764
Genome map
AA seq 133 aa AA seqDB search
MKQRDIQVLQEMGLTYWQVRKPEFFPNMQVPVIDLPESCKLLFITDNELNEHDAWLFGRI
LGSMKLTPEQALSLPLEAVEQVAEHHLTWCWFAGCQGAHPVGCQVLNSSSLQAMHSNPSS
KKALWQQICSYDK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtgatattcaggtattgcaagaaatggggttaacctattggcaggtacgc
aaaccggagttcttccctaatatgcaagtacctgtcatcgatctacctgaaagttgcaaa
ctattgtttattactgataatgaattgaatgaacatgatgcttggctatttgggcgtatt
ttaggcagtatgaaattgacgcctgaacaagcgttatcattgcctttagaagcggtagag
caagttgcagaacatcatttaacctggtgttggtttgcaggttgccaaggcgcacaccct
gttggttgccaagtgttaaattccagttcattgcaagcaatgcattcaaacccatcaagt
aaaaaagccttatggcagcagatttgttcttatgataaataa

DBGET integrated database retrieval system