KEGG   Photobacterium profundum: PBPRA0623Help
Entry
PBPRA0623         CDS       T00173                                 

Definition
DNA polymerase III, psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ppr  Photobacterium profundum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PBPRA0623
   00240 Pyrimidine metabolism
    PBPRA0623
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PBPRA0623
   03430 Mismatch repair
    PBPRA0623
   03440 Homologous recombination
    PBPRA0623
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PBPRA0623
DNA replication proteins [BR:ppr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PBPRA0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:681363..681764
Genome map
AA seq 133 aa AA seqDB search
MKQRDIQVLQEMGLTYWQVRKPEFFPNMQVPVIDLPESCKLLFITDNELNEHDAWLFGRI
LGSMKLTPEQALSLPLEAVEQVAEHHLTWCWFAGCQGAHPVGCQVLNSSSLQAMHSNPSS
KKALWQQICSYDK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtgatattcaggtattgcaagaaatggggttaacctattggcaggtacgc
aaaccggagttcttccctaatatgcaagtacctgtcatcgatctacctgaaagttgcaaa
ctattgtttattactgataatgaattgaatgaacatgatgcttggctatttgggcgtatt
ttaggcagtatgaaattgacgcctgaacaagcgttatcattgcctttagaagcggtagag
caagttgcagaacatcatttaacctggtgttggtttgcaggttgccaaggcgcacaccct
gttggttgccaagtgttaaattccagttcattgcaagcaatgcattcaaacccatcaagt
aaaaaagccttatggcagcagatttgttcttatgataaataa

DBGET integrated database retrieval system