KEGG   Photobacterium profundum: PBPRA0623Help
Entry
PBPRA0623         CDS       T00173                                 

Definition
DNA polymerase III, psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ppr  Photobacterium profundum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppr00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ppr03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ppr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:681363..681764
Genome map
AA seq 133 aa AA seqDB search
MKQRDIQVLQEMGLTYWQVRKPEFFPNMQVPVIDLPESCKLLFITDNELNEHDAWLFGRI
LGSMKLTPEQALSLPLEAVEQVAEHHLTWCWFAGCQGAHPVGCQVLNSSSLQAMHSNPSS
KKALWQQICSYDK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtgatattcaggtattgcaagaaatggggttaacctattggcaggtacgc
aaaccggagttcttccctaatatgcaagtacctgtcatcgatctacctgaaagttgcaaa
ctattgtttattactgataatgaattgaatgaacatgatgcttggctatttgggcgtatt
ttaggcagtatgaaattgacgcctgaacaagcgttatcattgcctttagaagcggtagag
caagttgcagaacatcatttaacctggtgttggtttgcaggttgccaaggcgcacaccct
gttggttgccaagtgttaaattccagttcattgcaagcaatgcattcaaacccatcaagt
aaaaaagccttatggcagcagatttgttcttatgataaataa

DBGET integrated database retrieval system