KEGG   Photobacterium profundum: PBPRA0631Help
Entry
PBPRA0631         CDS       T00173                                 

Gene name
SO1218
Definition
(GenBank) putative thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ppr  Photobacterium profundum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PBPRA0631 (SO1218)
Enzymes [BR:ppr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PBPRA0631 (SO1218)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:690681..691913
Genome map
AA seq 410 aa AA seqDB search
MSEGQIAAFAMAIYFNDMTMDERVALTCAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDV
TSLMLGPMVAACGGFVPMISGRGLGHTGGTLDKLESIPGYNITPTNDVFGQVTKDAGVAI
IGQTGDLAPADKRVYATRDVTATVDNISLITASILSKKLAAGLGSLVMDVKVGSGAFMPT
YEASEDLAKSIVAVANGAGTKTTALLTDMNQVLASTAGNALEVREAVQFLTGEYRNPRLF
EVTMALCAEMLVNSGLASDIEQAREQLQAVLDNGKAATCFGKMVAGLGGPVDFMENYDNY
LEKAEIAKPVFAETTGYAYAMDTRGLGMAVVGMGGGRRVASDSIDYAVGLSDMIRLGDEV
NTDTALCVIHARSEAQWQEAANAVRANITIADEKPAPTPDVYRRIRAEDI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaaggtcaaattgctgcgtttgcaatggcaatttactttaatgatatgaccatg
gatgagcgtgtagcactgacctgtgcaatgcgcgattctggcatggtaatcgactggagc
cacatgaactttgatggccctatcgtcgacaaacactctaccggtggtgtgggtgacgta
acatctttgatgcttggccctatggttgcagcatgtggtggtttcgtaccaatgatttca
ggccgaggcttgggacacactggcggtacgctagataaattagaatcgattcctggttac
aatatcactcctaccaatgacgtattcggtcaagtgaccaaagatgcaggtgtggcgatt
attggccagacaggcgatcttgcaccagcagataagcgtgtgtacgccactcgtgacgta
acagcaacggttgataatatctcattgatcaccgcttctatcttgtcgaaaaaactggct
gcgggcttaggctctttggttatggatgtgaaagtaggttcgggcgcattcatgccaact
tatgaagcatctgaagacttggcgaaatcgatcgtagctgtggcaaatggtgctggcacc
aaaacgacagcattgttgactgatatgaaccaagtattggcgtctactgccggtaatgct
ttggaagtacgcgaagccgtacaattcctcactggtgaataccgtaaccctcgcttattt
gaagtgaccatggcattgtgtgctgaaatgcttgtaaacagtggcttagcctcagatatt
gagcaagcacgtgagcagttacaagcggttctggataacggtaaagcagcaacatgcttc
ggcaaaatggttgcaggtttaggtggcccagttgatttcatggaaaattacgacaactac
ctagagaaagcagagattgctaagccagtgtttgcggaaacaacaggttacgcttacgcc
atggatacccgtggtttaggtatggcggttgtgggcatgggtggcggtcgccgtgtggcg
agtgacagcattgattacgcggtaggtttgagcgacatgatccgtttgggtgatgaagtg
aatacagataccgcgttatgtgtgatccatgctcgtagcgaagcacagtggcaagaagcg
gcaaatgccgtacgtgctaatatcactattgctgatgaaaagcctgcgccaacccctgac
gtttaccgtcgtattcgcgctgaagatatttaa

DBGET integrated database retrieval system