KEGG   Photobacterium profundum: PBPRA0631Help
Entry
PBPRA0631         CDS       T00173                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ppr  Photobacterium profundum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PBPRA0631 (deoA)
Enzymes [BR:ppr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PBPRA0631 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:690582..691913
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRKKRDNVELTADEINFFIQGIAKETVSEGQIAAFAMAIYFNDMTMDERVALT
CAMRDSGMVIDWSHMNFDGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLESIPGYNITPTNDVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDVTATVDNI
SLITASILSKKLAAGLGSLVMDVKVGSGAFMPTYEASEDLAKSIVAVANGAGTKTTALLT
DMNQVLASTAGNALEVREAVQFLTGEYRNPRLFEVTMALCAEMLVNSGLASDIEQAREQL
QAVLDNGKAATCFGKMVAGLGGPVDFMENYDNYLEKAEIAKPVFAETTGYAYAMDTRGLG
MAVVGMGGGRRVASDSIDYAVGLSDMIRLGDEVNTDTALCVIHARSEAQWQEAANAVRAN
ITIADEKPAPTPDVYRRIRAEDI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccgcaagaaataattagaaaaaaacgtgataacgttgaattaactgctgac
gaaattaacttcttcattcaaggcatcgcaaaagaaacggtgtctgaaggtcaaattgct
gcgtttgcaatggcaatttactttaatgatatgaccatggatgagcgtgtagcactgacc
tgtgcaatgcgcgattctggcatggtaatcgactggagccacatgaactttgatggccct
atcgtcgacaaacactctaccggtggtgtgggtgacgtaacatctttgatgcttggccct
atggttgcagcatgtggtggtttcgtaccaatgatttcaggccgaggcttgggacacact
ggcggtacgctagataaattagaatcgattcctggttacaatatcactcctaccaatgac
gtattcggtcaagtgaccaaagatgcaggtgtggcgattattggccagacaggcgatctt
gcaccagcagataagcgtgtgtacgccactcgtgacgtaacagcaacggttgataatatc
tcattgatcaccgcttctatcttgtcgaaaaaactggctgcgggcttaggctctttggtt
atggatgtgaaagtaggttcgggcgcattcatgccaacttatgaagcatctgaagacttg
gcgaaatcgatcgtagctgtggcaaatggtgctggcaccaaaacgacagcattgttgact
gatatgaaccaagtattggcgtctactgccggtaatgctttggaagtacgcgaagccgta
caattcctcactggtgaataccgtaaccctcgcttatttgaagtgaccatggcattgtgt
gctgaaatgcttgtaaacagtggcttagcctcagatattgagcaagcacgtgagcagtta
caagcggttctggataacggtaaagcagcaacatgcttcggcaaaatggttgcaggttta
ggtggcccagttgatttcatggaaaattacgacaactacctagagaaagcagagattgct
aagccagtgtttgcggaaacaacaggttacgcttacgccatggatacccgtggtttaggt
atggcggttgtgggcatgggtggcggtcgccgtgtggcgagtgacagcattgattacgcg
gtaggtttgagcgacatgatccgtttgggtgatgaagtgaatacagataccgcgttatgt
gtgatccatgctcgtagcgaagcacagtggcaagaagcggcaaatgccgtacgtgctaat
atcactattgctgatgaaaagcctgcgccaacccctgacgtttaccgtcgtattcgcgct
gaagatatttaa

DBGET integrated database retrieval system