KEGG   Photobacterium profundum: PBPRA0737Help
Entry
PBPRA0737         CDS       T00173                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppr  Photobacterium profundum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA0737
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRA0737
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRA0737
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PBPRA0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:816794..818407
Genome map
AA seq 537 aa AA seqDB search
MTEHQGNADYEVKLSLQTILTAEQQEILSSEALQFVERLVQRFASRVPQLLSAREERQQK
IDAGDLPDFLPDTMNIRNGNWRIQNIPTDLQDRRVEITGPVDRKMVINALNANVKVFMAD
FEDSFAPAWNEVLDGQRNLRDAVNDNISYTNPDNGKEYALNDDPAVLICRVRGLHLPEKH
LLWQGEPIPGSLFDFALYFFLNYKQLLEKGSGPYFYLPKLQAYQEAAWWSDVFSFTEDEF
GLQRGTIKATVLIETLPAVFEMDEILYSLKEHIVGLNCGRWDYIFSYIKTLRNHPDRILP
DRQVVTMEKPFLNAYSRLLVRTCHHRGAFAMGGMAAFIPSKEPERNAWVLNKIQTDKSLE
ANNGHDGTWVAHPGLADTARAVFDEALGTRNNQLDISREDDAPITAAELLAPCDGERTEE
GMRHNIRVAVQYIEAWITGNGCVPIYGLMEDAATAEISRASIWQWIKHGKSLSNGDVVTN
ALFEDMLDQEMVVLEQELGSERFQQGQYEEAAVLMSRLTTSDELVNFLTVSGYEYLA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacatcaaggcaacgcggattatgaagttaaactgtcattgcagacaatactg
acagcagaacaacaagaaatattaagtagtgaagccttgcagttcgttgagcgtttagtt
cagcgctttgcttcccgagttcctcaattactttctgcacgagaagagcgccaacaaaaa
atagatgctggagatctacctgattttctgccagatacgatgaatatacgcaacggtaat
tggcgtattcaaaatataccgaccgacctacaagaccgacgcgttgaaattaccggtccc
gttgaccgtaaaatggtgattaatgccctgaatgcaaatgtaaaagtattcatggctgat
tttgaagattcatttgcgccagcttggaatgaagtgcttgatgggcagcgtaatctgcgt
gatgcggtgaatgacaatattagctacaccaacccagataacggaaaagaatatgcgtta
aatgatgatccggcggtattgatttgtcgtgttcgtggtcttcatttaccagaaaagcat
ttgttgtggcaaggggagcctattcctggatcactgtttgattttgcattgtacttcttc
cttaactacaaacagttactagaaaaagggagcggcccttatttctacctgcccaaacta
caagcgtatcaagaagcggcatggtggagtgatgtctttagttttactgaagatgagttt
ggtttgcaacgcggcacaatcaaagcaacggtattgattgaaactttaccagccgttttt
gaaatggatgagattctttatagcttgaaagagcatattgttggtcttaattgtggccgt
tgggattatatttttagctatatcaaaacgctacgaaaccacccagatcgaatcttgcct
gacagacaagttgttacgatggagaagccatttctaaatgcttattcccgcttattggtg
cgtacttgtcaccatcgaggtgcgtttgcgatgggaggaatggctgcgtttattccatca
aaagagccagaacgtaatgcatgggtactcaataaaatccaaaccgataaatcattagaa
gcgaataatggccacgatggcacatgggttgcgcatcctggtttagccgatactgctcgt
gccgtgtttgatgaagcattgggtacacgcaataaccaattagatataagccgtgaagat
gacgcccctattactgcggcagagttgctcgctccatgtgacggtgaacgtacggaagag
gggatgcgccacaacattcgtgtcgctgttcagtacatagaagcatggattacgggtaat
gggtgtgtgcctatttatggactgatggaagatgcagcaaccgctgaaatatcacgcgct
tcaatttggcagtggattaaacacggtaaatcactgagcaatggtgatgtggtcaccaac
gcgttatttgaagacatgctagatcaagaaatggtggtattggaacaagagctaggaagc
gaacgattccaacaaggccagtatgaagaagctgcagtgcttatgtcgcgattaacaacc
agcgacgagcttgtgaacttcttaacagtttcaggttacgaatatctagcttag

DBGET integrated database retrieval system