KEGG   Photobacterium profundum: PBPRA0738Help
Entry
PBPRA0738         CDS       T00173                                 

Gene name
T4112
Definition
(GenBank) putative isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppr  Photobacterium profundum
Pathway
ppr00630  Glyoxylate and dicarboxylate metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01200  Carbon metabolism
Module
ppr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRA0738 (T4112)
Enzymes [BR:ppr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PBPRA0738 (T4112)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAG19151
UniProt: Q6LU74
Position
1:818530..819834
Genome map
AA seq 434 aa AA seqDB search
MTLTRQQQIEAIEKDWAENPRWKHVKRTYTAEEVVNLRGSFAPANTIAQRGADKLWDLVN
GSSKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVTRINNSFRRADQIQWSSGSNPEEGIDYFLPIVADAEAGFGGVLNAYELMRNMIDAGA
AGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVAGTTTLVIARTDANAADL
LTSDCDSYDNDFILGDRTAEGFYRVRAGIDQAISRGLAYAPYADLIWCETAKPCLEEARK
FAEAIHAQYPDQLLAYNCSPSFNWEKNLDDETIAKFQQELADMGYKYQFITLAGIHNMWY
NMFELAHAYAQGEGMRHYVEKVQRPEFEAAERGYTFVAHQQEVGTGYFDKMTNTIQGGQS
SVTALTGSTEEDQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacattgactcgccagcagcaaatagaagctattgaaaaagactgggctgaaaatcca
cgttggaagcacgttaaacgtacttacaccgcggaagaagtagtaaatctacgtggttca
tttgcccctgcaaatacgattgcccagcgcggcgctgataagctgtgggacttggtcaat
ggttcttcgaaaaaaggatatgttaactgtctaggtgcattgacgggtggccaagcagtt
caacaagcaaaagccggtattgaagcaatctacttatcgggttggcaggttgccgccgat
aacaatacggcatcgaccatgtatcctgatcagtcgttataccctgtagattcagtacca
tcagtggttactcgtattaataattcattccgtcgtgcagaccaaattcagtggtctagt
ggcagtaacccagaagaagggattgattacttcttaccgattgtcgccgatgcagaagcg
ggctttggtggtgtacttaatgcgtatgaacttatgcgcaatatgattgatgccggtgcc
gcaggtgttcactttgaagatcagttagcgtcagtgaaaaaatgtggtcacatgggcggt
aaagtcttggtgccaacccaagaagcagtacaaaaattagtggcggcacgtttagcggca
gacgtcgcgggtacaaccactttggttatagcgcgtaccgatgctaacgcggcagatttg
ttaacgtcagattgtgattcatacgataacgactttattctcggtgaccgtacagcggaa
ggtttctaccgcgtacgtgcaggtatcgaccaagctatctcgcgtggtttagcgtatgca
ccttatgctgatcttatttggtgtgaaactgcgaagccatgtttagaagaagcacgtaag
tttgctgaagcgattcatgcacagtaccccgatcaattattggcatataactgttcacca
tcgtttaactgggagaaaaacctggatgacgagacaattgctaagttccagcaagagttg
gcagatatgggctataaataccaattcatcacgttagcgggtattcataacatgtggtac
aacatgtttgaattagcccatgcttatgctcaaggtgaaggtatgcgtcactatgttgag
aaggtacagcgtcctgagtttgaagcggcagaacgtggatatacgtttgttgctcaccag
caagaggtcggtacgggttacttcgataagatgacaaatacgattcaaggtggtcaatct
tcagtaacggcattaacgggctctacggaagaagatcagttttaa

DBGET integrated database retrieval system