KEGG   Photobacterium profundum: PBPRA0778Help
Entry
PBPRA0778         CDS       T00173                                 

Gene name
XAC1888
Definition
(GenBank) Putative CheB, chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppr  Photobacterium profundum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PBPRA0778 (XAC1888)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PBPRA0778 (XAC1888)
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PBPRA0778 (XAC1888)
Two-component system [BR:ppr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PBPRA0778 (XAC1888)
Bacterial motility proteins [BR:ppr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PBPRA0778 (XAC1888)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:859450..860502
Genome map
AA seq 350 aa AA seqDB search
MVVDDSAVVRQVVSSVLKSDSEIEVCGAVADPLFAMTRMRMQWPDVIVLDIEMPRMDGIS
FLKKIMAERPTPVVICSTLTEKGADTTMQAISAGAVEIITKPKVGLKGFLHDSAKVLINA
VKAASRANLKPLQRAMASNLKVTPKLSADAVLAEGNTSRLKTTEQLVAIGTSTGGTQALE
LVLKALPRVSPGIVIVQHMPEKFTAAFAERLDSLCEISVKEAKHKMRVLPGQALIAPGGK
HMLLKRSGAQYYVEVIDGPLVSRHRPSVDVLFRSVAQSASGNALGIIMTGMGDDGVKGML
EMRRAGAVTLAQDEASCVVYGMPKEAVKCGAVERSLSLSEIPQAILDCSH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgatgactcagccgttgtgcgtcaggtggtttcttctgtattgaagagtgac
agtgagattgaagtctgcggcgctgtcgccgatcccctgtttgcgatgacacgaatgcgg
atgcagtggcctgatgtgatcgtactcgatattgagatgccccgcatggacgggatttca
tttcttaaaaagatcatggctgagcggccaacgccagtggtgatctgctccacattgacc
gaaaaaggggcggataccacgatgcaggcaatttcggccggtgcggttgaaatcattact
aaacccaaggtaggcctgaaaggtttcctgcatgactcagccaaagtattgataaatgct
gttaaagctgccagccgtgcaaacctgaagccgcttcagcgcgcgatggcatccaatctg
aaagtcactccaaaactaagtgccgacgctgtgttggcggagggcaatacatcgcggctt
aaaaccacagaacagctggtggcaataggtacgtctactggcggcactcaggcgttagag
ctggtgttgaaggcgctgccgcgggtttcaccggggatcgtgatcgtacagcatatgccg
gagaaattcactgccgcctttgccgagcggctcgacagcctttgcgaaatcagcgtaaaa
gaagctaagcataaaatgcgcgtgcttccaggccaggctttgattgcgcctgggggcaaa
cacatgctgttaaagcgcagtggtgctcaatattatgttgaagttattgatggcccttta
gtgagtcgtcaccgtccttctgtagatgtgttatttcgctcggtagctcaatcggcaagt
gggaatgcgctggggatcatcatgactggtatgggggatgatggcgtcaaaggaatgctg
gagatgcgacgggcaggagccgttactctggcgcaggatgaagccagttgtgtggtctac
ggtatgcccaaagaagcggttaagtgtggtgcggttgaacgcagcttgtcactctcggaa
ataccgcaagctattctcgactgcagtcattga

DBGET integrated database retrieval system