KEGG   Photobacterium profundum: PBPRA0962Help
Entry
PBPRA0962         CDS       T00173                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ppr  Photobacterium profundum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA0962 (fadJ)
   01212 Fatty acid metabolism
    PBPRA0962 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PBPRA0962 (fadJ)
   00650 Butanoate metabolism
    PBPRA0962 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PBPRA0962 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PBPRA0962 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PBPRA0962 (fadJ)
   00310 Lysine degradation
    PBPRA0962 (fadJ)
   00380 Tryptophan metabolism
    PBPRA0962 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PBPRA0962 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PBPRA0962 (fadJ)
   00281 Geraniol degradation
    PBPRA0962 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PBPRA0962 (fadJ)
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PBPRA0962 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PBPRA0962 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PBPRA0962 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1062596..1064743
Genome map
AA seq 715 aa AA seqDB search
MTQHESANSQPSAFSLTFGDNGVAWLKIDVPNERMNTLQSAFVDQVTDVLAQLKDKKDIK
GMVVYSGKPDNFIAGADIRMLAACQTADEAQQLAAKGQELFGQLEALPFHVVAAIHGPCL
GGGLELALACHSRVCSDDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVANALDMILTGKQ
LRAKKAKNLGLVEEAVPLSILLDIAEKQALKGKPKRKGSFQEWAMGGNALGRSVVFDQAA
KKTHEKTRGNYPAADAILDVIKYGLQHGMKKGLDQEAKRFGELVMTSESAALRSIFFATT
AMKKESGSDALPATIKKVGVLGGGLMGGGISHVTATKAGYPVRIKDISNDGIKNALVYNF
KLLDKQRKRRIISKAELQNKMFSITGGTTFTGFTNVDVVIEAVFEDINLKHQMVKDIEQQ
TSDYTIFASNTSSLPIHQIAAAAERPENVVGLHYFSPVEKMPLVEVIPHQGTENGSATSE
QTIATVVALAKKQGKTPIVVADKAGFYVNRILAPYMNEAAAVLLSGEPIEHIDRSLLDFG
FPVGPITLLDEVGVDIGAKISPILLAELGERFKAPDVFDLLLSDDRKGRKSGKGFYLYNT
KKKEVDKSVYKLLSLEPEQKAAGQDIALRCTLMMLNEAARCLDEGVIKSARDGDIGAIFG
IGFPPFLGGPFRYMDTLGAKRVVEMLKDHTDKYGGRFTPCDKLVAMANEEQSFYS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcatgaatctgcaaattcacaaccttccgctttctcgttaacgtttggcgat
aacggcgttgcttggttgaaaattgatgtgcccaacgaaagaatgaacacgttacaatca
gcatttgttgatcaagtaacagatgttcttgcacagttgaaagataagaaagacattaaa
ggcatggtggtgtattccggcaagcctgacaactttatcgctggtgctgatattcgcatg
ttggctgcatgccaaacggcagacgaagcacagcaattagccgcaaaagggcaagagctg
tttggtcaattagaagcattaccgtttcatgtagtcgctgccattcatggcccatgttta
ggcggtggcttagagcttgctttagcctgtcatagccgagtatgtagtgatgatgataaa
acacgcttaggtctgccagaagtacaattaggtttgctgcctggctctggtggcacgcag
cgtttaccgcgcttaattggcgtggctaatgcgttagatatgattctaacgggcaagcag
ctacgtgcaaagaaagcgaaaaacctgggtcttgtcgaagaagcggtgccattaagtatc
ttgcttgatatcgctgaaaaacaagctctgaaaggtaagccaaaacgcaagggctcgttc
caagagtgggcaatgggaggcaatgcactgggtcgttctgttgtttttgatcaagcagcg
aaaaaaacacatgaaaaaacccgcggtaattatcccgccgcagacgccatattagacgta
atcaaatatggtctgcaacatggtatgaagaaaggcttagatcaagaagccaagcgtttt
ggtgagctggtgatgacgtctgaatcggccgcattacgcagcatctttttcgcgacaaca
gccatgaaaaaagaatcaggttctgatgcactgccagcaacaatcaagaaggttggtgtg
ctgggtggtggcttgatgggcggtggtatcagccatgtaacggcaacgaaagccggctat
cctgttcgaattaaagatatatcaaacgatggtattaaaaatgcccttgtttataacttc
aagttactcgacaaacagcgtaaacgccgaatcatcagtaaggctgaactacaaaataaa
atgttcagtattacgggtggtacaacatttactgggtttacgaatgtcgatgtggtgata
gaagccgtttttgaagatattaatctaaagcaccaaatggtaaaagacattgagcagcaa
acatcggattatacgatttttgcgagtaacacatcgtcattgcctatccatcaaatcgca
gctgcagcagagcgtcctgaaaatgtggttggtttacactatttcagcccggtagaaaaa
atgcccttggttgaagttattccacatcaaggcactgaaaatggcagtgcgacctctgag
cagaccatcgctacagtcgtcgctttagcgaagaagcagggtaaaacgccgatagttgtc
gctgataaagcgggtttttatgtgaaccgtattctagcgccatacatgaatgaagccgct
gccgtgctattaagtggtgagccaatcgaacatatcgatcgttcattattggatttcggt
ttcccagtagggccaataaccttgctcgatgaagtcggtgtcgatattggtgcgaagatc
agcccgatattattggctgaattaggcgaacgatttaaagcgccggatgtattcgatcta
ttactgagtgatgatcgtaaggggcgcaagagcggtaaagggttctatctgtataataca
aagaagaaagaagttgataagagtgtttataaactgctttctttagaaccagagcaaaaa
gctgcggggcaagatattgcgcttcgctgtacgctaatgatgttgaatgaagcggcacga
tgccttgatgaaggtgttattaaatcagcacgagatggtgatattggcgcaatcttcggc
atcggtttcccaccattccttggcggtccattccgttatatggatacgttaggggctaaa
agggtggtagaaatgctgaaggatcatactgacaaatacggtggacgttttacgccgtgt
gacaagttggttgcgatggcaaatgaagagcaatctttctattcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system