KEGG   Photobacterium profundum: PBPRA1019Help
Entry
PBPRA1019         CDS       T00173                                 

Gene name
RECR
Definition
(GenBank) putative recombinational DNA repair protein
  KO
K06187  
recombination protein RecR
Organism
ppr  Photobacterium profundum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PBPRA1019 (RECR)
DNA repair and recombination proteins [BR:ppr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PBPRA1019 (RECR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PBPRA1019 (RECR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1128976..1129584
Genome map
AA seq 202 aa AA seqDB search
MRTSHLLEQLMEALRCLPGVGPKSAQRMAFNLLQRNRQGGLQLADALNRAMTDIGHCRDC
RTFTEDDICAVCANPRRQENGQICVVESPADIVAVESTGQFSGRYFVLMGHLSPLDGIGP
SDIGLDTLEFRLQKETIAELILATNPTVEGEATAHYIAELCHEYGVPATRIAHGVPVGGE
LELVDGTTLSHSLAGRQKLNLY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccagtcatttactggaacaattaatggaggccttacgttgtctacctggggtt
ggtcccaagtcggcgcagcgtatggccttcaatttgttgcagcgaaatcgccaaggcggt
ttacagcttgctgatgcattaaatcgcgcaatgactgatattggtcattgtcgtgattgc
cgtacattcactgaagatgacatttgtgcagtttgtgcgaatcctcgtcgtcaggaaaat
ggtcagatctgtgtggtagaaagccctgcagatattgttgcggttgaatcaacagggcag
ttttctggtcgttactttgtattgatgggtcacttatcgccattagatggtataggccct
tcagatatcggcttagatacgcttgagttccgactacaaaaagaaacgattgctgaatta
attttggcgacgaatcctactgtagaaggtgaagcaactgcgcattatattgccgaactt
tgccatgaatacggtgtaccagcaacgcgtattgcacatggtgtaccggtcggtggtgaa
ctagaacttgttgatggaacaaccctttctcattcattggcgggtcgccagaaactgaac
ttatattag

DBGET integrated database retrieval system