KEGG   Photobacterium profundum: PBPRA1033Help
Entry
PBPRA1033         CDS       T00173                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ppr  Photobacterium profundum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppr00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1147302..1150040
Genome map
AA seq 912 aa AA seqDB search
MECLTFKASIKIPLYGGFGRQIMSFISFKLTALASVIALAVTGCASQGSLEQNVVNNLAE
NLDVNYELVTNHGANEGLKCQELNAEWASCDLINLTLVNNGPAVDSKDWTIYFHSIRMIL
DVQNDQFKITHVTGDLHTLEPTDKFDGFAEGETVVIPYIGEYWTLFENDYMPRAYVVSGD
AKPKTIKSTDAEDPSAYLTPISGDNWKRTPDDNNVLATAQSRFEKNNDVNLIVKEELAGS
IIPTPLSTQLTGDSISLAGGINIENEAIPGSMMVALNDRLEMLGVNTEGQYAVKVTLDPT
LFTKEQKIEGAYQLDVRKDATYIVGYDYQGAFYGMQSLIALMTTGDKNTVPTVKITDAPR
FDYRGVMVDVGRNFHSKAAILRTLDQMSAYKMNKFHFHLTDDEGWRIEIPSLPELTGIGS
NRCHDLSETQCVLPQLGSGPTSDNFGSGFYSKQDYIDILMYAKARGIEVIPEIDMPAHAR
AAVVSMEARYKRLAATGDMEAANQYRLMDPQDTSNVTTVQFYDKRSFINPCMDSSVAFVD
KVIAEMAAMHKAAGMPLNTWHFGGDEAKNIKQGAGFQDINSADKVAWKGDLDLSQQDKPF
AKSPMCQQTINDGIVADYDHLPSYFAERVSQLVADHDIANFQAWQDGLKYSEDAEAFATD
NVRVNFWDVLYWGGGASAYDWSAKGYDLIVSNPDYVYMDMPYEVDPEERGYYWATRATDT
RKMFGFAPENLPQNAETSLDRDGNGFASKGTAEYKGFYGLSAQLWSETVRTDEQYEFMVF
PRVLAAAERAWHKADWEVDYKAGVEYSQQTNFVNKDALNAEWARFANVLGQRELAKLDAA
GIQYRVPVPGAKIENGRLQMNVSMPGLQLQYSTDGGDNWNIYNHDAQPVISGDVSVRAVS
TNGLRFSRVTSL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
ttggagtgcctaacttttaaggcctcgattaaaattcccctttatgggggcttcgggaga
caaatcatgagttttatttcttttaaattaactgcgctagcatcagttattgcattagca
gtaacagggtgtgcatcacaaggttcgcttgaacaaaacgttgtaaacaaccttgccgag
aatcttgatgttaattatgagcttgttacaaaccacggtgcaaacgaagggctgaaatgt
caggaattaaatgctgaatgggcatcgtgtgatttaattaatttgacgttagtaaataat
ggccctgctgttgatagcaaagattggactatctatttccacagtattcgtatgattttg
gatgttcagaatgaccaatttaaaatcactcatgtcactggtgacttacacacgctagag
ccaaccgataagtttgatggttttgcagaaggtgaaacggtcgttattccttacatcggc
gagtactggacgttgtttgaaaacgattatatgccccgtgcttatgttgtatcgggtgat
gctaagcctaaaacaatcaaaagtactgatgctgaagacccatctgcatacttaacacct
atttctggtgataactggaagcgtacgcctgatgacaataatgtattggcgacggcccag
tcgcgtttcgaaaaaaataacgatgttaatctaattgtaaaagaagagcttgcgggatca
attattccaacgcctttgagtactcagctaacgggtgattcaatatcattagctggcggc
attaatatcgaaaatgaagcgattccaggcagtatgatggttgcgctaaatgatcgctta
gagatgttaggtgtcaatactgaaggccaatatgcggtaaaagtgactttagacccaacg
ctgtttactaaagaacaaaaaattgaaggcgcttaccagttagatgtccgtaaagatgcg
acttacattgttggttatgattaccaaggtgctttctatggtatgcagtcgttgatcgca
ttgatgacaacgggtgataagaatacggttccaacggttaaaattacggatgctccacgc
tttgattaccgtggtgtaatggttgatgttggtcgtaactttcactctaaagccgctatt
cttcgtacgttagatcaaatgtcagcgtacaagatgaacaaattccacttccacctgact
gatgatgaaggttggcgtatcgaaatcccaagtttaccagaacttacgggtatcggctct
aatcgttgccatgacttatcagaaacacagtgtgtgttgcctcagctaggttctggtcca
acatcagataattttggttctggtttttactcgaagcaagattacatcgatatcttaatg
tatgcgaaggctcgcggcattgaagtgattcctgaaattgatatgccagcacacgcccgt
gctgcagtagtgtcaatggaagctcgttataagcgtttagctgcaacgggtgatatggaa
gcagccaatcaataccgtttgatggacccgcaagacacatcaaacgtaacgactgtgcaa
ttttatgataaacgtagcttcattaacccatgtatggattcatcggtagctttcgtcgat
aaagtgattgctgaaatggctgcaatgcataaagcagcgggtatgccacttaatacgtgg
cacttcggtggtgatgaagccaaaaacatcaaacaaggtgcgggtttccaagatataaat
tcagcagataaagtggcttggaaaggcgatcttgacctgtcacaacaagataagccattt
gcaaaatcaccaatgtgccagcaaacaattaatgacggtatcgttgcagattacgaccac
ttgcctagttattttgcagagcgtgttagccaactagtcgccgatcacgacattgcaaat
ttccaagcatggcaagatggcttgaagtattcagaagatgcagaagctttcgcaaccgat
aatgtgcgcgtgaacttctgggatgtactttactggggcggcggtgcttcagcttatgac
tggtcagctaaaggatacgatttaatcgtgtctaatcctgattatgtttacatggatatg
ccatacgaagtggatccagaagagcgaggttactactgggcaacacgtgcgacagatacg
cgtaaaatgtttggtttcgcaccagaaaacttgccacaaaatgcagaaacatcactcgat
cgtgatggtaacggttttgcaagcaaaggcacagcagaatacaaaggcttctatggctta
tcagctcaactttggagtgaaaccgtacgtaccgatgaacaatatgaattcatggtattc
ccacgtgttctagcggctgcagagcgtgcttggcataaagctgattgggaagtggattac
aaagctggcgttgagtattcacagcaaactaatttcgtgaataaagatgcgcttaatgca
gagtgggcacgttttgccaacgtattaggtcaacgtgaattggcgaagttagatgcggca
ggtattcaatatcgcgttcccgttcctggtgcgaaaattgaaaacggcagattacaaatg
aacgtgagtatgccaggtcttcaactacagtattctaccgatggcggtgataactggaat
atctataatcatgatgctcagccggtaatttcgggtgatgtatcggtgcgtgccgtgagt
acgaatggtttacgctttagtcgagtaacatcgttgtaa

DBGET integrated database retrieval system