KEGG   Photobacterium profundum: PBPRA1045Help
Entry
PBPRA1045         CDS       T00173                                 

Gene name
YPO1110
Definition
(GenBank) Putative succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppr  Photobacterium profundum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA1045 (YPO1110)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PBPRA1045 (YPO1110)
   00650 Butanoate metabolism
    PBPRA1045 (YPO1110)
  Energy metabolism
   00190 Oxidative phosphorylation
    PBPRA1045 (YPO1110)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1161542..1161889
Genome map
AA seq 115 aa AA seqDB search
MVNNVSTVGRNGIHDFILIRATAIILTLYTIYMVGFFAFGPDLSFETWTAFWGQLSTKVF
TMLALVSILVHAWIGLWQVLTDYIKCAALRAGIQFGVVVVLFVYLFSGFFIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtatccacagtcggccgtaatggtatccacgattttatcttgattcgc
gcaaccgcaatcattctaaccctttacaccatttatatggtcggttttttcgcttttggt
cctgaccttagttttgaaacttggactgccttttgggggcaactaagtactaaggttttc
actatgttggcattagtctcgattcttgttcacgcctggattggtttgtggcaggttttg
accgattacattaaatgtgctgctttgcgagcaggcattcagtttggtgttgtagtcgta
ctttttgtttacctattttcaggtttcttcattgtgtggggtgtgtaa

DBGET integrated database retrieval system