KEGG   Photobacterium profundum: PBPRA1063Help
Entry
PBPRA1063         CDS       T00173                                 

Gene name
SO2197
Definition
(GenBank) hypothetical GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PBPRA1063 (SO2197)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1180062..1181081)
Genome map
AA seq 339 aa AA seqDB search
MSTDSFVESTETLKKTVPLMMKYKVPITPTNYALWYTYTKQQTPELNLAIDQGIAELGLC
TPTLCESLYQEHLANQTEQDVRQVKQSLTAMVQELSHTMMDALSDTEAFQSVLTKSFDKL
ETAEQNGLSLDDTMKLVRDLIRESRQIQASTGTFKGQLSSAKDEITTLREALAESQKEAN
EDALTGILNRRAFDRDFQHYIESNTPLSFILLDIDKFKDFNDKFGHLMGDQVLKTIARRL
KVNCRDYAQAYRFGGEEFAIILPHKMKASARQQAETFRRAFERISVIDKKTGQRVNSITA
SFGVAEKQPNESGECLIDRADSFMNQAKKLGRNRVLPLN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagatagctttgttgaatcaactgaaacgttgaaaaaaaccgttcctcttatg
atgaaatacaaagtcccaataaccccgactaactacgctctttggtatacgtatacaaag
caacaaacccctgaactcaacctagcgattgatcaaggcattgctgaactcgggttatgt
acgcctacattgtgtgaatcgttatatcaagaacacttagccaatcaaactgaacaagat
gtacgacaagtgaagcagagcctaacggctatggtacaagagctatcacacacaatgatg
gatgcgttatctgataccgaagcattccaaagtgtattaacaaagagctttgataaactc
gaaaccgcagaacaaaatggtttatcgcttgacgatacaatgaagcttgttagagattta
attcgagagtctcgtcaaattcaagcctcgacgggtacatttaaggggcaattaagcagc
gcaaaagatgaaataaccacattacgagaagcccttgctgaaagccaaaaagaagccaat
gaagatgcgcttaccggtattttaaatcgccgcgcttttgaccgagatttccaacattac
atcgaaagcaacaccccactcagtttcattctgttagatatcgataaatttaaagatttc
aatgataagtttggccacttgatgggcgatcaagtactgaaaaccatcgcccgtcgctta
aaagtaaactgccgtgattatgctcaagcatatcgttttggaggcgaggaattcgctatt
attctcccccataaaatgaaggcatccgcacgtcaacaagctgaaacattcagacgagca
tttgaacgaatttctgtgattgataaaaaaacaggtcagcgtgttaactcaataaccgca
tcttttggcgttgcagaaaagcagccaaacgagtcaggtgaatgtttaattgaccgtgct
gatagctttatgaatcaggctaaaaaattgggtcgaaaccgcgtattacccttaaattaa

DBGET integrated database retrieval system