KEGG   Photobacterium profundum: PBPRA1085Help
Entry
PBPRA1085         CDS       T00173                                 

Definition
bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein (EC:3.5.4.19 3.6.1.31)
Orthology
K11755  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
ppr  Photobacterium profundum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PBPRA1085
  Amino acid metabolism
   00340 Histidine metabolism
    PBPRA1085
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     PBPRA1085
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     PBPRA1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1203949..1204572)
Genome map
AA seq 207 aa AA seqDB search
MSLVTTINWEKVDGLVPAVIQDNTSGQVLMLGYMNKEALNKTLETKQVTFWSRTKERLWT
KGETSGNVLELKSINLDCDQDTLLVKVNPVGPTCHLGTPTCFDNDAEGKQEQPALVFLHQ
LEQVLANRKGADPESSYTASLYARGTKRISQKVGEEGVEVALAATSGDKAELVCESADLI
YHLIVLLQDQGLSLSDVTEKLQERHNK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgtaacaacaattaattgggaaaaagtagacggattagtccctgctgtcatt
caagataacaccagtggtcaagtactgatgttagggtacatgaacaaagaagccttaaac
aaaacgctagaaacaaaacaagtcacgttctggtctcgcaccaaagagcgcctttggacg
aagggagaaacctctggcaatgtacttgagcttaaaagtatcaaccttgattgtgaccaa
gatacattattagtaaaagtaaaccctgtagggccaacttgtcacttaggtacaccaaca
tgcttcgacaacgatgcagaaggcaaacaagaacaacctgcattggtgtttcttcatcaa
cttgagcaagtcttggctaatcgtaaaggtgcagatcccgaatcttcttacacagccagc
ttatacgcccgtggcaccaagcgtatttcgcaaaaagtgggtgaagaaggcgttgaagtc
gcgcttgcggcaacgtcgggtgataaggcggaattagtgtgtgaatctgcagatctgatc
tatcacttgattgttttgctacaagatcaggggctaagcttgtctgatgttactgaaaaa
ctgcaagaacgtcataacaaataa

DBGET integrated database retrieval system