KEGG   Photobacterium profundum: PBPRA1085Help
Entry
PBPRA1085         CDS       T00173                                 

Definition
bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein (EC:3.5.4.19 3.6.1.31)
Orthology
K11755  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
ppr  Photobacterium profundum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1203949..1204572)
Genome map
AA seq 207 aa AA seqDB search
MSLVTTINWEKVDGLVPAVIQDNTSGQVLMLGYMNKEALNKTLETKQVTFWSRTKERLWT
KGETSGNVLELKSINLDCDQDTLLVKVNPVGPTCHLGTPTCFDNDAEGKQEQPALVFLHQ
LEQVLANRKGADPESSYTASLYARGTKRISQKVGEEGVEVALAATSGDKAELVCESADLI
YHLIVLLQDQGLSLSDVTEKLQERHNK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgtaacaacaattaattgggaaaaagtagacggattagtccctgctgtcatt
caagataacaccagtggtcaagtactgatgttagggtacatgaacaaagaagccttaaac
aaaacgctagaaacaaaacaagtcacgttctggtctcgcaccaaagagcgcctttggacg
aagggagaaacctctggcaatgtacttgagcttaaaagtatcaaccttgattgtgaccaa
gatacattattagtaaaagtaaaccctgtagggccaacttgtcacttaggtacaccaaca
tgcttcgacaacgatgcagaaggcaaacaagaacaacctgcattggtgtttcttcatcaa
cttgagcaagtcttggctaatcgtaaaggtgcagatcccgaatcttcttacacagccagc
ttatacgcccgtggcaccaagcgtatttcgcaaaaagtgggtgaagaaggcgttgaagtc
gcgcttgcggcaacgtcgggtgataaggcggaattagtgtgtgaatctgcagatctgatc
tatcacttgattgttttgctacaagatcaggggctaagcttgtctgatgttactgaaaaa
ctgcaagaacgtcataacaaataa

DBGET integrated database retrieval system