KEGG   Photobacterium profundum: PBPRA1103Help
Entry
PBPRA1103         CDS       T00173                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ppr  Photobacterium profundum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PBPRA1103
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA1103
   00620 Pyruvate metabolism
    PBPRA1103
   00650 Butanoate metabolism
    PBPRA1103
  Lipid metabolism
   00071 Fatty acid degradation
    PBPRA1103
  Amino acid metabolism
   00350 Tyrosine metabolism
    PBPRA1103
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PBPRA1103
   00626 Naphthalene degradation
    PBPRA1103
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PBPRA1103
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PBPRA1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1222327..1225032
Genome map
AA seq 901 aa AA seqDB search
MPVTNMAELDAMVARVKAAQQEFATFSQEQVDKIFRAASLAANNARIPLAQQAVAESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEENEEFGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNSTNAAAKLVLDAAVAAGAPKNIIGWIDQPSVELSNA
LMKHNDINLILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTF
DNGVVCASEQAVIVMDEVYDEVKARFASHNGYVLSKAEADKVRKILLINGNLNADIVGQP
ATKIAEMAGITVPADTKILIGEGDEVKYEDEFAHEKLSPTLGMFRASSFENAVEQACTMV
DIGGIGHTSGLYTNQDVNKDRIKYFGDKMKTARILVNIPTTHGGIGDLYNFNVAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKRA
FLVTDRFLFNNGYADDVVKLLKAQGIEVQTFFDVEADPTLSIVEKGAEAMKSFQPDVIIA
LGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGTG
SEVTPFAVVTDDKTGAKYPLADYELTPHMAIVDANLVMNMPRSLTAFGGYDAVTHALEAY
VSVLANEYSDGQALQALKMLKEYLPSSYANGANDPIAREKVHNAATIAGIAFANAFLGVC
HSMAHKVGAEFHVPHGLANALLISNTIRYNANDNPTKQTAFSQYASPQARRRYAEVADHL
SLSQAGDRTAQKIERLLTWLEELKIALDIPLSIQAAGIPEADFLAKLDQLSIEAFDDQCT
GANPRYPLISELKEVLTSAYYGTPYIEGETFEGTTVIKKSEPVVVAVKVEKVKAKKEAAK
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttacaaatatggctgaactagatgcaatggttgcccgcgtaaaagctgctcaa
caagagtttgcaactttctctcaagagcaagttgataaaatctttcgtgctgcttctcta
gctgcgaacaacgcacgtattcctctagctcaacaagctgtagctgagtctggtatgggt
attgttgaagataaggttatcaaaaaccacttcgcttcagaatttatctacaacaaatac
aaagacgaaaaaacgtgcggtattttggaagagaacgaagagttcggcaccatgactatc
gcagaaccagtaggtatcatttgcggtatcgtacccactacgaacccaacatctactgca
atcttcaaatctcttatctctcttaaaacacgtaacgcaattatcttctcgccacatcca
cgtgctaaaaactcaacgaacgctgctgctaaattagtgcttgacgctgctgttgctgct
ggcgcaccaaaaaacatcattggttggattgaccaaccttcagttgagctttcaaatgca
ttgatgaagcataacgacattaaccttattcttgcgactggtggtccaggtatggttaaa
gcggcttactcttcaggtaaaccagctatcggtgttggtgcgggtaacgtacctgtagtt
attgatgaaacggctgatattaagcgtgctgtagcatctgtgcttatgtctaagacattc
gataacggtgttgtatgtgcttctgagcaagcagttatcgttatggacgaagtctacgat
gaagtgaaagcacgctttgcttctcacaacggttatgtactgtctaaagctgaagcagat
aaagtacgtaaaatcttgcttatcaacggtaacctaaacgcagatatcgtaggccagcca
gcaactaaaattgctgaaatggcaggtattactgttcctgctgatactaagattcttatc
ggtgaaggcgatgaagttaagtacgaagacgaattcgcacacgaaaaactatctccaacg
ttaggtatgttccgcgcatcttcttttgaaaatgcagtagagcaagcttgtactatggtt
gatatcggcggtatcggtcacacatctggtctatacactaaccaagatgtaaataaagat
cgtatcaagtacttcggcgacaagatgaagactgcacgtattcttgtaaacattccgact
actcacggtggtatcggtgacctttacaactttaacgttgcaccttctctaactcttggt
tgtggttcatggggtggtaactctatctctgagaacgtaggtcctaagcaccttatcaac
aagaagactgtagcgaagcgagctgagaatatgttgtggcataaactaccaaaatcaatc
tacttccgtcgtggtagccttccaatcgcattgagcgatctagaaggcaagaaacgtgca
ttcctagttactgaccgtttcctattcaacaacggttatgctgatgatgtggttaaacta
cttaaagctcaaggtattgaagttcaaactttcttcgacgtagaagcggatccaacactg
tctattgttgagaaaggtgcagaagcgatgaagagcttccagcctgacgtaatcatcgcg
cttggtggtggttctccgatggatgctgcgaagatcatgtgggttatgtacgagcaccca
gaaactcactttgaagaactagcaatgcgctttatggatattcgtaagcgtatttacaag
ttccctaaaatgggtaaaaaagctgagctagtatgtatcacgactacatcaggtacgggt
tctgaagtaacacctttcgctgttgttacagacgataagacaggtgctaagtacccactc
gctgattacgaattaacacctcatatggctatcgttgatgcaaacttagtaatgaacatg
cctaggtcgctaacagcatttggtggttacgatgcagtaactcacgcactagaagcttac
gtttctgttcttgctaacgaatactctgatggccaggctcttcaagcacttaagatgctg
aaagaatacctaccttcaagctacgcaaatggtgcaaacgacccaatcgctcgtgagaaa
gtacacaatgcggcaactatcgctggtattgcgtttgcgaatgctttcctaggtgtgtgt
cactcaatggctcacaaagtgggtgcagagttccacgtaccacacggcttagctaatgca
ttgttgatttctaacacaattcgttacaacgcgaacgataacccaacaaaacaaacagcg
ttctctcagtacgcaagcccacaagctcgccgtcgttatgctgaagttgctgatcacttg
agtttatctcaagctggtgaccgtactgctcagaagattgaacgtctactaacatggtta
gaagagctgaaaattgcactggatatcccgctatcaattcaagctgcaggcattccagaa
gctgacttcctagcgaaactagaccaactatcaattgaagcgttcgatgatcagtgtact
ggtgctaacccacgttaccctcttatcagcgagctgaaagaagtactaacgtctgcttac
tacggtactccgtatatcgaaggtgaaactttcgaaggtacgactgtcattaagaagtct
gagccagtagtagttgctgtaaaagtagaaaaagtgaaagcaaagaaagaagcagctaaa
gcttaa

DBGET integrated database retrieval system