KEGG   Photobacterium profundum: PBPRA1116Help
Entry
PBPRA1116         CDS       T00173                                 

Definition
(GenBank) Putative holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppr  Photobacterium profundum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PBPRA1116
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PBPRA1116
DNA repair and recombination proteins [BR:ppr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PBPRA1116
    RecFOR pathway proteins
     PBPRA1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1238259..1238945
Genome map
AA seq 228 aa AA seqDB search
MLDIHPALYYPRANFNSYRDSAVIGRLSGTILEKQPPEVLIDVGGIGYEVQMPMSCFYEL
PEVGQAAVICTHFIVREDAQLLYGFNKKSERELFREVIKANGVGPKLGLAILSAMTASQF
VLSVENEDITTLVKIPGVGKKTAERLVIEMRDRLKGWGEGDLFTPASDAAASNAEIQKYS
SARAEDEAVSALIALGYKALQAAKVVSQVVKPEMSSENIIREALRSMV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatatccatccagcactttactatcctagagccaatttcaactcatacagagat
agtgcagtgattggccgacttagtggaaccattttagagaaacaaccaccagaagtatta
atagatgttggtggtatcggttatgaagttcaaatgccaatgagttgtttctatgagcta
ccagaggtaggtcaggctgcggtcatttgtacgcattttattgtccgtgaagatgcacaa
ttactgtatggctttaataaaaaaagcgaacgagagctttttcgtgaagttataaaagcc
aatggggttggcccgaagcttggtttagccattctttcagcgatgacggcaagccagttt
gttttgagtgttgaaaatgaagatattacgacattggtgaaaattcctggtgttggcaag
aaaacagcagagcgtttagtgatcgaaatgagagatcgcttgaaggggtggggtgaaggt
gatctattcacaccagcgtcagatgcagcagcatcaaatgccgaaatacaaaaatactcg
agtgcacgtgctgaagatgaagcggtaagtgcgcttattgctttaggttataaagcacta
caggcagcaaaagtggtatcccaagtggtgaagcctgagatgagcagtgaaaacatcatc
cgtgaagcattacgttcgatggtataa

DBGET integrated database retrieval system