KEGG   Photobacterium profundum: PBPRA1268Help
Entry
PBPRA1268         CDS       T00173                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ppr  Photobacterium profundum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PBPRA1268
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PBPRA1268
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PBPRA1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1436831..1439251)
Genome map
AA seq 806 aa AA seqDB search
MKMKPLALSLSLIISAFPALADKPNTDLQLMPYPQQVTLGDSEGLVVDRNFSAKLTGFTS
ERLESAMQRLNDRIERQTGFFLTTPIQTAGKTPQLIINVKAGSPTDVQQEKEDESYSLNV
TSTQAVLTANTPYGALHGIETFLQLLQNTPKGAEIPAVSIEDSPRFPWRGALIDTSRHFI
PVDVIKRQIDGLASAKFNTFHWHLTDDQGWRIESLAYPNLHEKGSDGLYYTREQMKDVVA
YAKNLGIRVIPEVDLPGHASAIAAAYPELMTEVKEYKIERKWGVHEPLLDPTKPEVYTFI
DKIIGEVAELFPDEYIHIGGDEVNPKQWNESKAVQTFMAEKGLKDALELHAFFNQEVEEI
LKKHDRKMIGWDETYHPDLPKSIVIQSWRGHDSLGESANDGYQGILSTGYYIDQAQPAAM
HYRNDPMPKPLQVDDEVHTDESWETWQFEAPRKRGSAVTGTFTLITAKDGTRRGFIDYKS
RSRRAVFDIETTQGITSFWMDSWMGQTKPRVELQGGKLTGHMVVGNAQYVMTGQKIAGND
IQNSQYPTAPYPVALKKEQEHLILGGEVTLWAENVKDDTIDLRMWPRSYVIAERLWSAET
ITDENSMYERMETMGNWATVSVGLQHEWNALVGMKRLASGQDIRPLQVLAEAVEQAQYYH
RHHEKSTYENYDRFDPLNRFADALPPESLEVRQLNKNVTAFIVNPKDSTAKIQIVEQLQS
WIDNNDALITMIDGNYLLKDIKPVAKHVTQVSQLGLDLIKQIESGKSLTTSDIDAAKNLL
NDAQQIQDEVVVSAAYPVEMLLHAAY
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaacctttggcactttctttatcgttaattatatcggcattccctgcattg
gctgataagcctaatactgatcttcaacttatgccctacccccaacaagtcacattaggt
gattcagaaggacttgttgttgatcgtaacttctctgctaaattaacgggattcacatca
gagcgattagagtctgccatgcaacgcttaaatgatcgtattgaacgccaaacaggtttt
tttctaacaacacccattcaaacagcgggcaaaacacctcagttaattatcaatgttaaa
gctggttccccaacagatgtacaacaagaaaaagaagatgaaagttacagcttaaacgtc
accagcacgcaagcagtacttactgccaatacgccttatggggcattgcatggcatcgaa
acattcttgcaattattacaaaacacgcccaaaggtgctgaaataccagcagtcagtatt
gaagactctcctcgcttcccatggcgtggtgcgttaattgatacctcacgccacttcatt
cctgttgatgttatcaaacgccaaattgatggtttagcctctgcgaagtttaataccttc
cattggcacttaacagacgatcagggctggcgtattgaatctttggcttaccccaaccta
cacgaaaaagggtctgacggtctttactacactcgcgaacaaatgaaagacgttgttgct
tatgctaaaaatcttggcatacgtgtgattcctgaagttgacttaccaggccatgcatca
gcaattgctgcggcttacccagaactaatgaccgaagtaaaagaatataaaatcgaacgt
aaatggggtgtacatgaacccctactcgatccaacgaaacctgaggtatacaccttcatt
gataaaatcattggtgaggtagccgagttattcccagatgagtacattcacattggtggc
gatgaagttaatccaaaacaatggaatgaaagtaaagccgtacaaacgtttatggcagaa
aaagggctaaaggatgcccttgaattacatgcattctttaatcaagaagtcgaagagatt
cttaaaaaacacgatcgtaagatgatcggttgggatgaaacttaccatcctgatctgcca
aaaagcatcgtgattcaatcttggcgtggacacgattcattaggtgagtccgcaaatgat
ggttatcaaggtattctatctacgggatattacatcgaccaagcacaacccgcggccatg
cattaccgtaacgatccaatgcctaaacctctgcaggttgatgatgaagtacacacagat
gaaagctgggaaacgtggcaatttgaagcaccacgtaaacgtggcagcgctgttacaggt
acatttacgctaatcacagctaaagatggtactcgccgtggctttattgattacaaaagc
cgttcacgtcgtgctgtctttgatattgaaaccacccaaggtattacctctttctggatg
gattcttggatggggcaaactaaaccacgcgttgagttacaaggtggaaaactcaccggg
catatggtggtaggtaacgcacaatatgtaatgactggtcagaaaattgcggggaatgat
attcagaacagccaatacccaacagcaccttaccctgtcgcattaaagaaagaacaagag
caccttattctgggtggtgaagtcactttatgggcagaaaatgttaaagacgatactatc
gatcttcgtatgtggccacgttcttacgttattgctgaacgtttgtggtcggctgaaacc
attaccgatgaaaatagtatgtatgaacgtatggaaacgatgggcaactgggcaaccgtt
tctgtgggtttacagcatgaatggaatgctctggttggaatgaaacgcctcgccagtggg
caagatattcgaccactgcaagtgttagccgaagccgttgaacaagcgcagtactatcac
cgtcaccacgaaaaatcgacatatgaaaattatgaccgatttgatcccttaaaccgtttt
gcagatgcacttccaccagaaagccttgaagttcgccaattgaataagaacgtaacggca
tttattgtgaatccgaaagattccacagccaaaatacaaatagtggagcaactgcaaagc
tggatcgataacaatgatgcattgataacaatgatcgacggtaactatttattaaaagac
atcaaacccgtggctaagcatgttactcaagtttcgcaactggggcttgatctcattaaa
caaattgaatcaggaaagtctttaacaactagcgacatagatgcagctaaaaatctgctt
aacgacgcacagcaaattcaagatgaggtggtggtatcagccgcttaccctgttgaaatg
ttgctacatgctgcgtactaa

DBGET integrated database retrieval system