KEGG   Photobacterium profundum: PBPRA1722Help
Entry
PBPRA1722         CDS       T00173                                 

Gene name
CV2676
Definition
(GenBank) hypothetical endoglucanase precursor
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PBPRA1722 (CV2676)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1970919..1972028
Genome map
AA seq 369 aa AA seqDB search
MKKLVLIIGFILSYQVNASTCSWPEWEQFKSTYIQSGRVIDGSDTRQITTSEGQSYGLFF
AVVANDPTAFKAVLNWTETHLSGGDLTARLPAWLWGKKDFNTFGVLDNNPASDSDLWIAY
SLIEAGRLWGEYYYESLGYLLASRIIREETREVEGIGTVLLPGKKGFDNGKGQLRLNPSY
VPLFLIKNMASHYPNDQWQSLYNSSYTMLEKTMPKGFSPDWVTLSNATFYADAETGPIGS
YNAIRTYLWAGMLNDKTEEKETLLSMMSPMVNAIKQLQAPPRSVNTETGTFKDGGSAGFS
AALLPLLQSLGEKELAIEQAKVVSMLLQSNSNDYYYDNVLALFGMGWYQGKYHFGINGEL
QPSWVEQCQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttagtattaattattggctttattctttcttatcaagtaaatgccagtact
tgtagttggcctgaatgggaacaatttaaatcgacatatatccaaagtggaagagtgatt
gacggtagcgatacacgacaaatcaccacctcagaagggcaatcttatggtttgtttttt
gcggtagtcgctaatgatcctactgcatttaaggcagtgttaaattggaccgaaacccac
ctatctgggggcgatttaacggcacgcttgcctgcttggttatggggaaagaaagatttt
aatacatttggcgtacttgataacaaccctgcatctgattcagatttatggatagcatac
agcttaattgaagcgggtcgtttatggggagagtattactatgaatcgctaggctatttg
ttagcaagccgtatcatacgtgaagaaacacgtgaagttgaaggcatagggacagtttta
ctaccagggaaaaagggctttgataatggcaaagggcagctgcgccttaacccaagttat
gtgccactatttctgattaaaaatatggcatcccattacccgaatgatcaatggcaatct
ttatacaattcaagctacaccatgttagaaaagacgatgccaaaaggttttagtcctgat
tgggtgactttgtctaatgcaacgttttacgctgatgcagaaacgggacctattggtagc
tacaatgcgataagaacttacctatgggcaggcatgttaaatgataaaacggaggaaaaa
gaaaccttattatcaatgatgtcaccaatggtgaatgccataaagcaactacaggcgcca
cctcgaagtgtgaatactgaaaccggcacatttaaggacgggggtagtgctggcttttct
gccgctttattaccgttattacaatcgttaggtgaaaaagaattggcgatagaacaagcc
aaggtcgtatctatgttgcttcaatctaatagtaatgattattactatgacaacgtgtta
gctttatttggcatggggtggtatcaaggtaaatatcactttggaatcaatggtgaacta
caaccttcttgggttgagcaatgtcagtga

DBGET integrated database retrieval system