KEGG   Photobacterium profundum: PBPRA1815Help
Entry
PBPRA1815         CDS       T00173                                 

Definition
ATP-dependent exoDNAse (exonuclease V), alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppr  Photobacterium profundum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2091798..2093969
Genome map
AA seq 723 aa AA seqDB search
MQDKLTAYIRVRTIWKEGDRFFLNGKIVRRDSLQVATALSYVAVNVHMDSLHAKPKKGDY
WKVTGTYEYRTETYSNNYERTRVYFENPSSLELTMPNDIDEMITFISDSKEFYRIGRKTM
MDAQDVLREELFPSIINKDLEKLRTAFTDKQVETLINGFERFENLRHSIWLSQHHIPPNI
QQKLFKLNKSFDPRDIKNNPYELVTLGLSFEQADKIAKESFGFTEDHPYRLIGATNDALK
SISKWGNTWATADQVLPLVRKRLKLDVNEFDLTESAMSLAVRKFGFTEINGRFHHGTYLF
MEMVITHRFKSMLSKKAEWTDLHPEVINKAMENNPFSLTEKQAEAVFKALEYNLATIIGG
AGTGKTTVLRTVLRAFHELGYNIHAVALAGKAAMTLKKSVGFQTSTIARFLGQKPLVEGK
HVVIIDEASMVDLPTMFQIVLHCSPDVRFILVGDDNQLASIRAGLVLTDMVRSGVIPVTE
LDIVQRQEGTTGIPVYSALIKDGIVPSELTTGNIHFHECQPTRIIDACANLYAEDPLNSQ
IIVATNDMKDAINKYCQNTFNGSAEPLIVDMGYRKFGTKFRKGDPVIFTKNNYEVDIQNG
TLGKLISVTPDEKKGSFGEVVLNGGRTVLLTQELLAKLDLAYGITLHKGQGSQFKRVIVA
VENSGLVDRSWVYTGITRAEVELHLFGEEYKLISAITGLSAKYKRQTYLADLLKEHIERA
WVG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataagttaacagcatacatccgagttcgtaccatttggaaagaaggtgaccgt
tttttcctgaatggaaaaatagtcagacgtgatagtttgcaggttgctactgctctatct
tatgttgccgttaacgtgcatatggatagtctacatgctaaacctaagaaaggagattac
tggaaggttactggaacatatgaatatcgcaccgaaacatattcgaacaactatgagaga
acaagggtttacttcgagaacccatctagccttgaactaacaatgccaaacgatattgat
gaaatgataacttttatttctgatagcaaagagttttatcgaattggcaggaagactatg
atggatgcacaggatgtattgcgagaagagttattcccctcaattatcaataaagaccta
gagaaattaaggacagcgtttaccgataagcaagtagaaaccttgatcaatggctttgag
cgttttgaaaacctacgccattcgatttggctctcacagcatcacattcctccaaatatc
caacagaaactcttcaaattaaacaagtcatttgatccgcgagatataaagaacaatcct
tatgagttggtaacgctaggattatccttcgagcaggcagacaagatagcaaaagagtca
tttggctttactgaagaccatccatatcgacttataggtgcgactaatgatgcactgaaa
tctatatcaaaatggggaaacacatgggcaacggctgaccaagtattaccgctagttcgg
aaacggcttaaacttgacgttaatgagtttgaccttactgaaagcgcaatgtcattagcc
gttcgcaaatttggcttcactgaaataaacggcagattccaccacggaacctatttgttt
atggaaatggtgataactcatcgtttcaaaagtatgctttccaaaaaagcagaatggact
gacttgcaccctgaagttattaataaggcgatggagaacaacccattttcactcactgaa
aagcaagctgaagctgtatttaaagctcttgaatacaacctcgctacaataattggtggc
gctggtacaggtaagacaacggtattgcgtactgtcttaagagcctttcatgaattaggc
tataacatccatgcagttgcgttggctggtaaagctgcgatgacgttaaaaaagtcagtt
ggttttcaaacatcaaccattgcacgatttctcggccagaagcctctggtagaaggaaag
catgtcgttattatcgatgaggcatcaatggttgatttaccaaccatgtttcagatagtg
cttcactgtagcccagacgttcgttttatattggtaggtgatgataaccagcttgcatct
attagagctggattggttctaactgatatggttcgttctggagtgatacccgtgactgag
ttagatatagtgcaacggcaggaaggaactacgggtattccagtttattctgcgctcatt
aaagatgggatcgtcccaagcgaattgacgacaggtaatatccactttcatgaatgtcag
ccaacaagaattatcgatgcctgtgcgaatctttacgctgaagacccgctaaacagccag
ataatagtcgcaacaaacgacatgaaggatgccatcaataagtattgccaaaatacattt
aatgggtcggcggaaccattaatagttgacatgggttacaggaaattcggtactaagttc
agaaaaggtgacccagtaatatttactaagaacaactatgaggtcgatatccaaaatggg
acgctaggaaagctcattagtgtaacgcccgatgagaagaagggttcatttggtgaggtt
gtgcttaatggcggaaggacagttttattaacccaagaattattggcgaaattggatttg
gcatatggtataacgctccataaagggcaaggttcacaattcaagcgggtaatagttgct
gtcgagaatagtggtctagttgaccgttcatgggtatatacaggcatcacaagggcagaa
gtagaattacatttgtttggggaagagtataagttaattagcgccattacaggtctaagc
gcaaaatataaacggcagacatatctggcggatttactaaaagagcacatcgagcgcgct
tgggtcggttga

DBGET integrated database retrieval system