KEGG   Photobacterium profundum: PBPRA2084Help
Entry
PBPRA2084         CDS       T00173                                 

Gene name
S3323
Definition
(GenBank) putative evolved beta-D-galactosidase, alpha subunit
  KO
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ppr  Photobacterium profundum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PBPRA2084 (S3323)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PBPRA2084 (S3323)
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PBPRA2084 (S3323)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2401125..2404118
Genome map
AA seq 997 aa AA seqDB search
MLLSGQWTFNFFNNPMLVPDEFYNQEMSEWDSIQVPNMWQMEGHGKLQYTDEGFPFPIDV
PFVPTNNPTGAYQRTFTLGDGWDKQQTIIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFD
ISEQVKVGKNLLSVRVMQWADSTYIEDQDMWWTAGIFRDVYLVGKKPVHVYDYTIRTDFD
AQYQSATLSGSVVIENLQTAQASGFQLEYALYDGNQLISDGSVDNLAIEECHTATFAIDV
TNPVHWTAENPHLYHLFLTLKDHAGTIIEIIPQRVGFRDIKVKDGLFYINNQYTMLHGVN
RHDNDHLNGRAAGIDRVEKDLILMKQHNINSVRTAHYPNDPRFYEMCDIYGLFVMAETDV
ETHGFANVGDLSRITDDAEWENVFVDRIERQIHAQKNHPSIIMWSLGNESGYGCNIRAMC
KAAKAIDDTRLVHYEEDRNAEVVDIVSTMYSRVQLMNYFGEQPMDKPRIICEYAHAMGNG
PGGLTEYQNVFYKHNHIQGHFLWEWCDHGILEQDEKGRDVYKYGGDYGDYPNNYNFCMDG
LVYSDQTPGPGLREYKQVICPVKVSVKDAENGLITVENKYWFSTLDDITLLVDIRAEGET
LAQYQLSATNVKVGESCDLQVALPELDEREVFINVSVRKNSSTRYSVANSELGIFQFQIK
ENTAQLPTFTHTNSTALNVQEQRLEWIVEGYNFELTFSKISGQLTSWLSNGIEIIASSPK
MNFFKPMIDNHKQEYEGLWEPAHLQIIEEHFRTLEVEQQNGCVIVTVNSIVAPPVLDFGM
RCTYIYEIHSEGQVNLSLTGKKYGEYPHVIPVLGLDMGINNQFEQVEYYGRGPEENYLDS
KQCNIIDVYQSTVTKMFENYPFPQNNGNRQDVRWASLVNRQGNGLFVKPEQPINLSAWHY
TSEHLHEAQHINELEKSGYITLNLDHKLMGLGSNSWGSEVLDSYRVYMNDFQYALTLVPF
SQANCRANYLAGQDFSLKTQTDQNIQENTPSMIGGDK
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgctacttagtgggcagtggacatttaattttttcaataatccaatgcttgttcctgat
gaattttacaatcaagaaatgtctgaatgggatagcattcaagttccgaacatgtggcaa
atggaaggtcatggtaagcttcaatacactgatgaaggctttcctttccctattgacgtt
ccttttgttccgactaacaaccctacaggtgcatatcaacgtactttcacattgggtgac
ggatgggataaacaacaaacaatcatcaaattcgatggcgttgaaacctattttgaagtg
tatgtaaatggtcagtatgtagggttcagtaaaggcagccgcctaacagcggagtttgat
atttcagaacaagtaaaagtgggtaaaaatttactctctgttcgtgttatgcaatgggct
gattctacctacatcgaagatcaagacatgtggtggacagctgggattttccgtgacgtt
tacctcgtaggtaaaaagccagttcatgtttatgattacacaatacgcacagatttcgat
gcacaatatcaaagtgctacactttctggttctgtcgtcatcgaaaacttacaaacagca
caggcttcaggcttccaacttgaatatgctttatacgacggcaatcagcttatctccgat
ggctcagtcgataacctagctatcgaagaatgccacacagctacttttgctattgatgtg
actaaccctgttcactggacagccgaaaatccgcacttatatcacctattcctcacgctt
aaagatcatgctggcactattatcgagatcattccacagcgtgttggtttccgcgacatt
aaagtaaaagatggcctgttctatatcaataaccagtacaccatgcttcatggggttaac
cgccacgacaatgatcatttaaatggtcgagccgcaggcattgatcgtgtcgaaaaagac
ctgatcttgatgaaacaacacaacattaactcagtgcgtaccgcacactaccctaatgat
cctcgcttctatgaaatgtgtgatatttacggtttgtttgtgatggctgaaaccgatgta
gaaacccatggttttgctaacgttggcgacttaagccgtattaccgatgatgccgaatgg
gagaatgtgttcgttgatcgtattgaacgtcaaattcatgcgcaaaagaaccaccctagt
atcatcatgtggtctttaggtaatgagtctggctacggctgcaatattcgcgcaatgtgt
aaagcagcaaaagccattgatgatacccgccttgttcattatgaagaagatcgtaatgct
gaagttgtagatattgttagcaccatgtactcccgcgttcagctgatgaattattttggt
gaacaacccatggacaagcctcgcattatttgtgagtacgctcatgcaatgggtaatggt
ccgggcggactaactgaatatcaaaatgtcttctacaaacataatcatattcaagggcat
ttcttatgggagtggtgtgatcacggtattcttgaacaagacgaaaaagggcgtgacgtt
tataaatacggtggtgactacggtgattacccgaataattataacttctgcatggatggt
ttggtgtattctgatcaaactcctggtccaggtttacgtgaatacaagcaagttatctgc
ccagtaaaagtcagtgtaaaagatgcagaaaatggccttatcactgttgaaaacaaatac
tggttctcgaccttagatgacatcaccttactggtcgatattcgtgctgaaggtgaaaca
ctggctcaataccaactttcagcaaccaatgtaaaagtaggtgaaagctgtgaccttcaa
gttgctctacctgaattagatgaacgtgaagtcttcattaatgtctcagtacgtaaaaat
tcaagtacgcgctacagtgtcgcaaatagcgagctgggcatattccaattccaaataaaa
gaaaataccgcgcaattacctacattcacacacacaaatagcactgcgcttaatgttcaa
gagcaacgcctagagtggatagttgaaggttacaacttcgagctgacgttctctaaaatt
agcggtcaattaacatcttggctgagcaacggtattgaaataatcgctagctcaccaaag
atgaatttcttcaagccaatgatcgacaaccataagcaagagtatgaaggtttatgggag
ccggctcacctgcaaataatagaagaacacttccgcacgctagaggtagaacagcaaaat
ggatgcgttatcgttacggttaacagcattgttgctccgccagttttagattttggtatg
cgttgcacttatatctatgaaattcattcagaaggtcaagtaaacctctctcttacaggc
aaaaaatacggtgaatacccacatgttattcctgtacttggattggatatggggatcaat
aatcaattcgaacaagttgaatattacgggcgtggtcctgaagaaaattacctcgatagt
aaacagtgcaacatcattgatgtttaccaatcaacagtaacaaaaatgttcgagaactac
cctttcccacaaaacaacggcaaccgccaagacgtgcgctgggcctcactcgtgaaccgc
caaggtaatggactatttgtaaaaccagaacagcctattaatttaagtgcatggcattac
accagtgaacacttgcatgaagcacaacacatcaatgaattagaaaaaagcggttatatc
acgctaaatcttgaccataagctaatgggattaggctcgaactcttggggttctgaagta
ttagattcttaccgtgtttacatgaacgatttccaatacgccttaacgctagtgccattt
agccaagcgaattgccgtgcaaattacttggcggggcaagatttttcactcaaaacacaa
acagaccaaaacattcaagaaaatacaccaagcatgattggcggagataaataa

DBGET integrated database retrieval system