KEGG   Photobacterium profundum: PBPRA2084Help
Entry
PBPRA2084         CDS       T00173                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ppr  Photobacterium profundum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppr00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppr00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:2401002..2404118
Genome map
AA seq 1038 aa AA seqDB search
MNNWENFNHLSENRIAPRAYFFSYDALNKAKSFQRDLSSHFMLLSGQWTFNFFNNPMLVP
DEFYNQEMSEWDSIQVPNMWQMEGHGKLQYTDEGFPFPIDVPFVPTNNPTGAYQRTFTLG
DGWDKQQTIIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISEQVKVGKNLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLVGKKPVHVYDYTIRTDFDAQYQSATLSGSVVIENLQT
AQASGFQLEYALYDGNQLISDGSVDNLAIEECHTATFAIDVTNPVHWTAENPHLYHLFLT
LKDHAGTIIEIIPQRVGFRDIKVKDGLFYINNQYTMLHGVNRHDNDHLNGRAAGIDRVEK
DLILMKQHNINSVRTAHYPNDPRFYEMCDIYGLFVMAETDVETHGFANVGDLSRITDDAE
WENVFVDRIERQIHAQKNHPSIIMWSLGNESGYGCNIRAMCKAAKAIDDTRLVHYEEDRN
AEVVDIVSTMYSRVQLMNYFGEQPMDKPRIICEYAHAMGNGPGGLTEYQNVFYKHNHIQG
HFLWEWCDHGILEQDEKGRDVYKYGGDYGDYPNNYNFCMDGLVYSDQTPGPGLREYKQVI
CPVKVSVKDAENGLITVENKYWFSTLDDITLLVDIRAEGETLAQYQLSATNVKVGESCDL
QVALPELDEREVFINVSVRKNSSTRYSVANSELGIFQFQIKENTAQLPTFTHTNSTALNV
QEQRLEWIVEGYNFELTFSKISGQLTSWLSNGIEIIASSPKMNFFKPMIDNHKQEYEGLW
EPAHLQIIEEHFRTLEVEQQNGCVIVTVNSIVAPPVLDFGMRCTYIYEIHSEGQVNLSLT
GKKYGEYPHVIPVLGLDMGINNQFEQVEYYGRGPEENYLDSKQCNIIDVYQSTVTKMFEN
YPFPQNNGNRQDVRWASLVNRQGNGLFVKPEQPINLSAWHYTSEHLHEAQHINELEKSGY
ITLNLDHKLMGLGSNSWGSEVLDSYRVYMNDFQYALTLVPFSQANCRANYLAGQDFSLKT
QTDQNIQENTPSMIGGDK
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
gtgaataactgggaaaactttaaccatcttagcgaaaatagaatagcgccacgcgcttac
ttcttctcttacgacgcattaaataaagctaagagttttcaacgagatctgagtagtcac
ttcatgctacttagtgggcagtggacatttaattttttcaataatccaatgcttgttcct
gatgaattttacaatcaagaaatgtctgaatgggatagcattcaagttccgaacatgtgg
caaatggaaggtcatggtaagcttcaatacactgatgaaggctttcctttccctattgac
gttccttttgttccgactaacaaccctacaggtgcatatcaacgtactttcacattgggt
gacggatgggataaacaacaaacaatcatcaaattcgatggcgttgaaacctattttgaa
gtgtatgtaaatggtcagtatgtagggttcagtaaaggcagccgcctaacagcggagttt
gatatttcagaacaagtaaaagtgggtaaaaatttactctctgttcgtgttatgcaatgg
gctgattctacctacatcgaagatcaagacatgtggtggacagctgggattttccgtgac
gtttacctcgtaggtaaaaagccagttcatgtttatgattacacaatacgcacagatttc
gatgcacaatatcaaagtgctacactttctggttctgtcgtcatcgaaaacttacaaaca
gcacaggcttcaggcttccaacttgaatatgctttatacgacggcaatcagcttatctcc
gatggctcagtcgataacctagctatcgaagaatgccacacagctacttttgctattgat
gtgactaaccctgttcactggacagccgaaaatccgcacttatatcacctattcctcacg
cttaaagatcatgctggcactattatcgagatcattccacagcgtgttggtttccgcgac
attaaagtaaaagatggcctgttctatatcaataaccagtacaccatgcttcatggggtt
aaccgccacgacaatgatcatttaaatggtcgagccgcaggcattgatcgtgtcgaaaaa
gacctgatcttgatgaaacaacacaacattaactcagtgcgtaccgcacactaccctaat
gatcctcgcttctatgaaatgtgtgatatttacggtttgtttgtgatggctgaaaccgat
gtagaaacccatggttttgctaacgttggcgacttaagccgtattaccgatgatgccgaa
tgggagaatgtgttcgttgatcgtattgaacgtcaaattcatgcgcaaaagaaccaccct
agtatcatcatgtggtctttaggtaatgagtctggctacggctgcaatattcgcgcaatg
tgtaaagcagcaaaagccattgatgatacccgccttgttcattatgaagaagatcgtaat
gctgaagttgtagatattgttagcaccatgtactcccgcgttcagctgatgaattatttt
ggtgaacaacccatggacaagcctcgcattatttgtgagtacgctcatgcaatgggtaat
ggtccgggcggactaactgaatatcaaaatgtcttctacaaacataatcatattcaaggg
catttcttatgggagtggtgtgatcacggtattcttgaacaagacgaaaaagggcgtgac
gtttataaatacggtggtgactacggtgattacccgaataattataacttctgcatggat
ggtttggtgtattctgatcaaactcctggtccaggtttacgtgaatacaagcaagttatc
tgcccagtaaaagtcagtgtaaaagatgcagaaaatggccttatcactgttgaaaacaaa
tactggttctcgaccttagatgacatcaccttactggtcgatattcgtgctgaaggtgaa
acactggctcaataccaactttcagcaaccaatgtaaaagtaggtgaaagctgtgacctt
caagttgctctacctgaattagatgaacgtgaagtcttcattaatgtctcagtacgtaaa
aattcaagtacgcgctacagtgtcgcaaatagcgagctgggcatattccaattccaaata
aaagaaaataccgcgcaattacctacattcacacacacaaatagcactgcgcttaatgtt
caagagcaacgcctagagtggatagttgaaggttacaacttcgagctgacgttctctaaa
attagcggtcaattaacatcttggctgagcaacggtattgaaataatcgctagctcacca
aagatgaatttcttcaagccaatgatcgacaaccataagcaagagtatgaaggtttatgg
gagccggctcacctgcaaataatagaagaacacttccgcacgctagaggtagaacagcaa
aatggatgcgttatcgttacggttaacagcattgttgctccgccagttttagattttggt
atgcgttgcacttatatctatgaaattcattcagaaggtcaagtaaacctctctcttaca
ggcaaaaaatacggtgaatacccacatgttattcctgtacttggattggatatggggatc
aataatcaattcgaacaagttgaatattacgggcgtggtcctgaagaaaattacctcgat
agtaaacagtgcaacatcattgatgtttaccaatcaacagtaacaaaaatgttcgagaac
taccctttcccacaaaacaacggcaaccgccaagacgtgcgctgggcctcactcgtgaac
cgccaaggtaatggactatttgtaaaaccagaacagcctattaatttaagtgcatggcat
tacaccagtgaacacttgcatgaagcacaacacatcaatgaattagaaaaaagcggttat
atcacgctaaatcttgaccataagctaatgggattaggctcgaactcttggggttctgaa
gtattagattcttaccgtgtttacatgaacgatttccaatacgccttaacgctagtgcca
tttagccaagcgaattgccgtgcaaattacttggcggggcaagatttttcactcaaaaca
caaacagaccaaaacattcaagaaaatacaccaagcatgattggcggagataaataa

DBGET integrated database retrieval system