KEGG   Photobacterium profundum: PBPRA2276Help
Entry
PBPRA2276         CDS       T00173                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppr  Photobacterium profundum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA2276
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRA2276
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRA2276
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PBPRA2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2621419..2623065
Genome map
AA seq 548 aa AA seqDB search
MISEDMVIERQSMCIDVLGTTDNAEYKQVLSTEALLFLDAVVKKFAERRSELLALRDQRQ
LTFDNGELPDFRQDTKDIRDDKSWKVAPIPAALQDRRVEITGPIDRKMVINALNSGAKVF
MCCFEDASAPSWENMINGQINLRDANAGTISYTDEAKNKHYELNDNPALLIARPRGLHLP
EDHIQYNGQPIPGSLMDFALYFFHNYQTRAAQGLGVYYYIPKLESMEEAQWWDDIFNFTE
NYFKVETGTIRATVLIETLPAVFQMDEILYVMRNHIVAMNCGRWDYIFSYIKTLKNHKDR
ILPDRHGVGMDKTFLNAYSQLLVRTCHQRGALAMGGMSAFIPHKDPKVMDQVLAKVVEDK
NRESNNGHDGTWVAHPHLVSTAMDIFDKHLAGKTNQLDFDSSYVGDITAKTLLEPCEGVR
NEEGVRKNIRIALYYIESWIQGIGCVPIYGLMEDAATAEISRANIWQWIYHGVSLDDGQV
FTASLFRKWLNEELNTIKIEVGQTRYNNGRFEETAALFDQISTAEEFAAFLTLPSYSLLT
GQRIQTLT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagaagatatggtgattgaacgacaatcaatgtgtattgatgtactcggcaca
acggataatgcagagtacaaacaagtgttatcaacggaagcactgcttttccttgatgcg
gtagtaaagaaatttgctgaacgccgtagtgaactattagcgttacgtgatcaacgccaa
ctcacgtttgataacggcgaattacctgatttccgtcaagatactaaagatattcgtgat
gataaaagctggaaagtggcaccgatccctgcagcacttcaagatcgtcgcgtggaaatt
accggtcctatcgatcgtaagatggtgatcaacgcactgaattctggtgcaaaagtcttt
atgtgctgctttgaagatgcatcagcaccttcgtgggaaaatatgatcaatggtcagatc
aatttacgcgatgccaatgcaggcacaatcagttataccgatgaagcaaagaacaaacat
tatgagttaaacgataatccagcattacttattgctcgcccgcgtggtttgcacttgcct
gaagatcatattcaatataacggtcaacccattcccggtagcttgatggatttcgcactg
tacttcttccacaactatcaaacacgcgcagcacaagggcttggagtgtattactacatt
cctaaacttgaaagtatggaagaggcccaatggtgggatgatattttcaactttaccgaa
aactatttcaaggttgaaactggcacaattcgcgccacggtattaatcgaaaccttaccc
gcagtatttcaaatggatgaaatactgtatgtaatgcgaaatcatattgtggcaatgaac
tgtggtcgttgggactatatctttagctacattaaaacactgaaaaaccataaagatcgt
attctgcctgaccgccatggtgtaggtatggataaaaccttcttaaatgcgtacagccag
ctgcttgtacgtacctgccatcaacgtggtgcgctagccatgggcggcatgtcggcattt
attccccataaagatcctaaagttatggatcaagtgttagcaaaagtcgttgaagataaa
aaccgtgaatctaataacggtcatgacggtacttgggttgcccaccctcaccttgtttca
accgcgatggatatttttgataagcaccttgcgggtaaaacaaaccaactcgatttcgat
tcaagctatgtcggcgatattacagccaagacattgcttgaaccctgtgaaggtgtgcgt
aatgaagaaggtgtacgtaaaaatattcgtattgccctttattacatcgagtcatggatt
cagggtattggctgcgtgcctatttatgggctaatggaagatgccgcaactgccgagatt
tcacgtgccaatatctggcaatggatttaccacggtgtatcactcgatgatggtcaggta
ttcacggcttctcttttccgcaagtggctaaacgaagaactcaacacgattaaaattgaa
gtcgggcaaacccgctataacaacggtcgcttcgaagaaactgcggcgttatttgaccaa
atttcgaccgctgaagaatttgcagcgttcttaactttaccgagttattccctactaaca
ggacaaagaattcaaacattaacctaa

DBGET integrated database retrieval system