KEGG   Photobacterium profundum: PBPRA2276Help
Entry
PBPRA2276         CDS       T00173                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppr  Photobacterium profundum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PBPRA2276
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRA2276
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRA2276
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PBPRA2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2621419..2623065
Genome map
AA seq 548 aa AA seqDB search
MISEDMVIERQSMCIDVLGTTDNAEYKQVLSTEALLFLDAVVKKFAERRSELLALRDQRQ
LTFDNGELPDFRQDTKDIRDDKSWKVAPIPAALQDRRVEITGPIDRKMVINALNSGAKVF
MCCFEDASAPSWENMINGQINLRDANAGTISYTDEAKNKHYELNDNPALLIARPRGLHLP
EDHIQYNGQPIPGSLMDFALYFFHNYQTRAAQGLGVYYYIPKLESMEEAQWWDDIFNFTE
NYFKVETGTIRATVLIETLPAVFQMDEILYVMRNHIVAMNCGRWDYIFSYIKTLKNHKDR
ILPDRHGVGMDKTFLNAYSQLLVRTCHQRGALAMGGMSAFIPHKDPKVMDQVLAKVVEDK
NRESNNGHDGTWVAHPHLVSTAMDIFDKHLAGKTNQLDFDSSYVGDITAKTLLEPCEGVR
NEEGVRKNIRIALYYIESWIQGIGCVPIYGLMEDAATAEISRANIWQWIYHGVSLDDGQV
FTASLFRKWLNEELNTIKIEVGQTRYNNGRFEETAALFDQISTAEEFAAFLTLPSYSLLT
GQRIQTLT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagaagatatggtgattgaacgacaatcaatgtgtattgatgtactcggcaca
acggataatgcagagtacaaacaagtgttatcaacggaagcactgcttttccttgatgcg
gtagtaaagaaatttgctgaacgccgtagtgaactattagcgttacgtgatcaacgccaa
ctcacgtttgataacggcgaattacctgatttccgtcaagatactaaagatattcgtgat
gataaaagctggaaagtggcaccgatccctgcagcacttcaagatcgtcgcgtggaaatt
accggtcctatcgatcgtaagatggtgatcaacgcactgaattctggtgcaaaagtcttt
atgtgctgctttgaagatgcatcagcaccttcgtgggaaaatatgatcaatggtcagatc
aatttacgcgatgccaatgcaggcacaatcagttataccgatgaagcaaagaacaaacat
tatgagttaaacgataatccagcattacttattgctcgcccgcgtggtttgcacttgcct
gaagatcatattcaatataacggtcaacccattcccggtagcttgatggatttcgcactg
tacttcttccacaactatcaaacacgcgcagcacaagggcttggagtgtattactacatt
cctaaacttgaaagtatggaagaggcccaatggtgggatgatattttcaactttaccgaa
aactatttcaaggttgaaactggcacaattcgcgccacggtattaatcgaaaccttaccc
gcagtatttcaaatggatgaaatactgtatgtaatgcgaaatcatattgtggcaatgaac
tgtggtcgttgggactatatctttagctacattaaaacactgaaaaaccataaagatcgt
attctgcctgaccgccatggtgtaggtatggataaaaccttcttaaatgcgtacagccag
ctgcttgtacgtacctgccatcaacgtggtgcgctagccatgggcggcatgtcggcattt
attccccataaagatcctaaagttatggatcaagtgttagcaaaagtcgttgaagataaa
aaccgtgaatctaataacggtcatgacggtacttgggttgcccaccctcaccttgtttca
accgcgatggatatttttgataagcaccttgcgggtaaaacaaaccaactcgatttcgat
tcaagctatgtcggcgatattacagccaagacattgcttgaaccctgtgaaggtgtgcgt
aatgaagaaggtgtacgtaaaaatattcgtattgccctttattacatcgagtcatggatt
cagggtattggctgcgtgcctatttatgggctaatggaagatgccgcaactgccgagatt
tcacgtgccaatatctggcaatggatttaccacggtgtatcactcgatgatggtcaggta
ttcacggcttctcttttccgcaagtggctaaacgaagaactcaacacgattaaaattgaa
gtcgggcaaacccgctataacaacggtcgcttcgaagaaactgcggcgttatttgaccaa
atttcgaccgctgaagaatttgcagcgttcttaactttaccgagttattccctactaaca
ggacaaagaattcaaacattaacctaa

DBGET integrated database retrieval system