KEGG   Photobacterium profundum: PBPRA2489Help
Entry
PBPRA2489         CDS       T00173                                 

Gene name
trpC, trpF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ppr  Photobacterium profundum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PBPRA2489 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PBPRA2489 (trpC)
Enzymes [BR:ppr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PBPRA2489 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PBPRA2489 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2882707..2884077
Genome map
AA seq 456 aa AA seqDB search
METVLARIVADKRIWVEARKQSQPLESFVDTITPSDRSFYDALTSDTAAFILECKKASPS
KGQIRENFDLDYIASVYNNHANAISVLTDEKYFQGNFDFLPQVRNQVRQPVLCKDFMIDT
YQVYLARHYQADAILLMLSVLNDEEYRELSTLAHSLNLGVLTEVSNEEELERAIALQAKV
VGINNRNLRDLSIDLNRTKELAPRLPEGTIVISESGISTNQQIRDLSAYANGFLIGSSLM
SEDNLELAVRRVLLGENKVCGLTHADDASAAYQSGAVYGGLIFVSSSPRHVDIEQARMVM
SGAPLKYVGVFRNADPEAVKKAAESLALSAVQLHGDETPEYVTNLKTQLPVDCEIWKAHG
VEAELPDFSRWQADKHLLDSKVGQQSGGTGKTFDWSLLSETAKENILLAGGLTPSNVSEA
VKLGCHGLDLNSGVESAPGKKDQTKLNAAFAAIRKY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtactagcaagaatcgttgcagataaacgcatttgggttgaagcgcgtaaa
caaagccagcctcttgaaagctttgttgatacgataacacccagtgatcgtagcttttat
gatgcactgaccagcgatactgccgctttcattttagagtgtaaaaaggcatcaccgtct
aaaggtcaaattcgtgaaaacttcgatcttgattacattgccagtgtgtacaacaaccac
gccaatgcgatttcagtattaacagacgagaagtactttcaaggcaactttgattttctg
ccgcaagtgcgcaaccaagttcgccaacctgttctctgtaaagatttcatgatcgatact
tatcaggtttaccttgcacgccattatcaagcggatgccattctcttaatgctatcggta
ctgaatgacgaagaataccgcgagctatcaacactggcgcactcgctaaatttgggcgtg
ttaacggaagtcagcaacgaagaagaacttgagcgtgcaatcgcattacaagccaaagtg
gttgggatcaataaccgtaacttgcgcgatctaagcatcgatttaaatcgtacaaaagag
ctagcaccccgcttgcctgaaggtacgattgtcatctctgaatcgggtattagtactaac
caacaaatccgtgatttatcggcatatgcgaatggcttcttaattggaagttcgctaatg
tctgaagacaatctagaactggctgtgcgacgagtactgcttggtgagaataaagtctgt
ggtttaacccatgctgacgatgcatcagcggcctatcaaagcggtgctgtgtacggtggt
ttgatttttgtttcctcgtcacctcgccatgtcgatatcgaacaagcccgtatggtgatg
agtggcgccccccttaaatatgtcggcgttttccgtaatgctgatcctgaagcggtcaaa
aaagctgctgagtcattggcgctgtctgccgtacagttgcacggtgatgaaacaccggaa
tatgtcacgaatttaaaaacacagcttcccgttgattgcgaaatttggaaagcccacggg
gtagaagcagaattacccgacttttcccgttggcaagccgataagcacctactcgatagc
aaagtgggtcaacaaagtggcggcacaggcaaaacatttgattggtcgttactgagtgaa
acagcgaaagaaaatattttattagctggcgggcttaccccaagcaatgtcagcgaagca
gtcaagcttggttgccacggattagatttaaactccggtgtagaaagcgcgccgggtaaa
aaagatcaaacaaaattgaatgcggcatttgcagcaatcagaaagtattaa

DBGET integrated database retrieval system