KEGG   Photobacterium profundum: PBPRA2491Help
Entry
PBPRA2491         CDS       T00173                                 

Gene name
PLU2467
Definition
(GenBank) putative tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppr  Photobacterium profundum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PBPRA2491 (PLU2467)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PBPRA2491 (PLU2467)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PBPRA2491 (PLU2467)
Enzymes [BR:ppr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PBPRA2491 (PLU2467)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2885283..2886092
Genome map
AA seq 269 aa AA seqDB search
MDRYQELFNRLAAKNEGAFVPFVTIGDPTPEQSMKIIDTLVASGADALELGIPFSDPLAD
GPTIQAATIRALESGTTPIVCFELLTQIRAKYPDMPIGLLMYANLVFTAGIETFYKKCAD
AGVDSVLIADVPIKESEEFRVAAEKYGIHPIFIAPPNATDETLKSVSELGGGYTYLLSRA
GVTGAETKAGKPIRHLVESLTKHNAPPALLGFGISEPAQVKEAIEAGAAGAISGSAVVKI
IENNLSDHTAMLDNLGQFIRDMKAASKLS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttatcaagaattatttaatcgcctagcagcaaaaaatgaaggcgcatttgtt
cctttcgtaacgattggcgacccaacccctgagcaatcaatgaaaatcattgatacgtta
gttgcatcgggtgccgatgcgctggaattaggtatcccgttctcagacccattggctgat
ggcccaaccattcaagcagcaactattcgtgctcttgaatctggcacaacacctattgtg
tgtttcgaactattaactcaaattcgcgcaaaataccctgacatgccaattggcttgtta
atgtatgcaaacttggtgtttactgctggcatcgaaaccttctataaaaagtgtgccgat
gcgggtgtcgactctgtattgattgcagatgtaccaatcaaagagtctgaagaatttcgt
gtggccgctgaaaaatacggcattcaccctatctttattgcaccacccaacgcgactgat
gaaacattgaaatcagtctctgaattaggcggtggttacacatatctactgtctcgcgct
ggtgtcacaggtgctgaaacaaaagcaggtaagccaattcgccacttagtcgaaagtctt
actaagcataatgctccaccagccctacttgggtttggtatatctgaaccagcacaagta
aaggaagcgattgaagcaggtgctgcaggtgcaatttctggttctgctgtagtcaaaatc
atcgaaaataacctaagcgatcatactgcaatgcttgataatttaggccaatttattcgt
gacatgaaagcagcaagtaagcttagctaa

DBGET integrated database retrieval system