KEGG   Photobacterium profundum: PBPRA2603Help
Entry
PBPRA2603         CDS       T00173                                 

Gene name
Z2820
Definition
(GenBank) hypothetical protein
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppr  Photobacterium profundum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA2603 (Z2820)
Enzymes [BR:ppr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PBPRA2603 (Z2820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:3014991..3015866
Genome map
AA seq 291 aa AA seqDB search
MDLRKLSTINALSDAVTICKFQGVKIVRVIHDTAEAGISLHGGHLIWFKPAGEQDVIWLS
EKAEFDTTKAIRGGIPVCWPWFGKAATPSHGFARNSQWTLKEHRENSNGVIISLMLEDSE
STREMWPHKFKNELIFEIGTELKVHLTSTNVDDHSWSYGGALHTYFTVADINTVEITDMG
KEYIDSTQGDKAVQGGNTLVFTQEVDRVYTSPQDIITINDKNNTRQISVKNQGHNAAVIW
NPWQDLSISMSGMADNSFETMVCVESTIYGQGIELAPGQSHTLSTLISVKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgtaagctttcaacgattaatgcactttcagatgctgttaccatttgtaaa
tttcagggcgtgaaaatagttcgcgttattcatgatactgccgaagcgggtatatctctt
catggtggacacctgatttggttcaaaccagcaggtgagcaagatgtaatatggcttagt
gaaaaagctgagtttgatacaactaaagccattcgtggcggtattcctgtctgttggccc
tggtttggaaaagcagcaacaccgtctcatggtttcgcacgaaacagccaatggacactc
aaagaacaccgtgaaaatagcaatggcgtgattatttcgctgatgttagaagactctgaa
tcaacacgtgaaatgtggccacataaattcaaaaatgaactgatttttgaaattggcaca
gaacttaaagtccacttaacatcaaccaatgtcgatgatcatagctggtcatacggcggt
gccttacacacttactttactgttgcagatatcaatactgttgaaattacagatatgggt
aaagaatatatcgatagtacacagggtgataaagccgtacaaggtggcaacacactcgta
tttactcaagaagtggatcgcgtttatacctcaccacaagatatcatcaccattaatgat
aaaaacaatacacgccaaatttcagttaaaaaccaaggccataatgcagcggttatttgg
aatccttggcaagacttatcaatcagtatgagtggcatggcagataacagctttgaaacc
atggtgtgcgttgaatcaacgatttatggtcaaggtattgagttagcacccggtcaatct
cacaccctaagcacactgatttctgtgaaaaagtaa

DBGET integrated database retrieval system