KEGG   Photobacterium profundum: PBPRA2603Help
Entry
PBPRA2603         CDS       T00173                                 

Gene name
Z2820
Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppr  Photobacterium profundum
Pathway
ppr00010  Glycolysis / Gluconeogenesis
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA2603 (Z2820)
Enzymes [BR:ppr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PBPRA2603 (Z2820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4766
Motif
Other DBs
NCBI-ProteinID: CAG20982
UniProt: Q6LNZ4
Position
1:3014991..3015866
Genome map
AA seq 291 aa AA seqDB search
MDLRKLSTINALSDAVTICKFQGVKIVRVIHDTAEAGISLHGGHLIWFKPAGEQDVIWLS
EKAEFDTTKAIRGGIPVCWPWFGKAATPSHGFARNSQWTLKEHRENSNGVIISLMLEDSE
STREMWPHKFKNELIFEIGTELKVHLTSTNVDDHSWSYGGALHTYFTVADINTVEITDMG
KEYIDSTQGDKAVQGGNTLVFTQEVDRVYTSPQDIITINDKNNTRQISVKNQGHNAAVIW
NPWQDLSISMSGMADNSFETMVCVESTIYGQGIELAPGQSHTLSTLISVKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgtaagctttcaacgattaatgcactttcagatgctgttaccatttgtaaa
tttcagggcgtgaaaatagttcgcgttattcatgatactgccgaagcgggtatatctctt
catggtggacacctgatttggttcaaaccagcaggtgagcaagatgtaatatggcttagt
gaaaaagctgagtttgatacaactaaagccattcgtggcggtattcctgtctgttggccc
tggtttggaaaagcagcaacaccgtctcatggtttcgcacgaaacagccaatggacactc
aaagaacaccgtgaaaatagcaatggcgtgattatttcgctgatgttagaagactctgaa
tcaacacgtgaaatgtggccacataaattcaaaaatgaactgatttttgaaattggcaca
gaacttaaagtccacttaacatcaaccaatgtcgatgatcatagctggtcatacggcggt
gccttacacacttactttactgttgcagatatcaatactgttgaaattacagatatgggt
aaagaatatatcgatagtacacagggtgataaagccgtacaaggtggcaacacactcgta
tttactcaagaagtggatcgcgtttatacctcaccacaagatatcatcaccattaatgat
aaaaacaatacacgccaaatttcagttaaaaaccaaggccataatgcagcggttatttgg
aatccttggcaagacttatcaatcagtatgagtggcatggcagataacagctttgaaacc
atggtgtgcgttgaatcaacgatttatggtcaaggtattgagttagcacccggtcaatct
cacaccctaagcacactgatttctgtgaaaaagtaa

DBGET integrated database retrieval system