KEGG   Photobacterium profundum: PBPRA2674Help
Entry
PBPRA2674         CDS       T00173                                 

Definition
UTP-glucose-1-phosphateuridylyltransferase, galU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppr  Photobacterium profundum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PBPRA2674
   00052 Galactose metabolism
    PBPRA2674
   00500 Starch and sucrose metabolism
    PBPRA2674
   00520 Amino sugar and nucleotide sugar metabolism
    PBPRA2674
Enzymes [BR:ppr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PBPRA2674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3102475..3103425)
Genome map
AA seq 316 aa AA seqDB search
MDNKMNKITKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYIVNECVAAGIKEIVLV
THSSKNAIENHFDTSYELEATLEKRVKRQLLDAVQSICPKDVTIMHVRQGHAKGLGHAVL
CAKPLIGDAPFVVVLPDVILDEYTADQSRENLAAMLARYESTQASQIMVEPVPMHDVSKY
GVVDCNGAALKGGESHPMTAMVEKPAMEEAPSNLAVVGRYVLSAKIWEKLAKTPPGAGDE
IQLTDAIDMLMADETVEAFHMTGKSHDCGDKLGYLKAFVEYGIRHESLGDDFKDYLVSSL
LVSSAEVASIEVASVE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttggacaacaaaatgaacaaaatcaccaaagccgtgatccctgtggcaggacttggcacg
cgtatgctacccgcaaccaaagccattccaaaagaaatgctgcccatcgtcgataaaccg
ctgatccaatacattgtcaatgaatgtgtggcggcggggatcaaagagattgtgttagtg
acacactcatcgaaaaatgcgatcgagaaccacttcgatacctcgtatgaattggaagcc
acccttgaaaaacgcgtaaagcgtcaattgcttgacgcagtgcaatcgatttgcccgaaa
gatgtgaccattatgcatgtacgccaaggccatgcgaaagggttagggcatgcggtattg
tgcgcgaaaccgttaattggtgatgcgccgtttgtggtggtattacctgatgtgatctta
gatgaatataccgcagatcaatcacgtgaaaacttggcggcgatgctagcgcgttatgaa
agtacccaagctagccaaattatggttgagccagtaccgatgcacgatgtgtcgaagtac
ggtgtggtcgattgtaatggtgctgctctaaaagggggcgagtctcacccaatgaccgcg
atggttgaaaagccggcgatggaagaggcgccgtcgaatttggcggttgttggtcgctat
gtattatctgccaaaatttgggagaagcttgcgaagacccccccgggtgcgggtgatgaa
attcagctgacggacgcgattgatatgctaatggccgatgaaaccgtggaagcctttcac
atgacaggtaaatctcacgattgtggtgataaattaggttacctgaaagccttcgtagag
tacggtatccgtcatgagtcattaggtgatgactttaaagattatctagtatcgagttta
ctcgtttcgagtgccgaggttgctagtatagaggttgctagtgtcgagtaa

DBGET integrated database retrieval system