KEGG   Photobacterium profundum: PBPRA2816Help
Entry
PBPRA2816         CDS       T00173                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppr  Photobacterium profundum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PBPRA2816
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PBPRA2816
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PBPRA2816
Lipid biosynthesis proteins [BR:ppr01004]
 Fatty acid synthase
  Component type
   PBPRA2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3261814..3262554
Genome map
AA seq 246 aa AA seqDB search
MPAPETPTSAIVSPCSTSRETSCKMVSEDDAVVTFLDTDTALITDVDMMRILSVLLIYLC
SLNAWGNTLLVVGDSLSAGYQMRAEQSWPVLLQPALKQQGHEITVVNASISGDTTGNGLA
RLPTLLQQHKPAYVIIELGANDGLRGFPQGTIRNNLSQMITEIQNADAKPMLVQIKVPPN
YGKRYSDMFSSIYPQLSKELATPLLPFFLEQIILKQEWMMNDGLHPKSDAQPWIAEYMAE
NIAPYL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgcgccagagacgccaacaagtgctattgtttctccttgctcgacctcgagggaa
acatcctgcaagatggtgagtgaggacgatgccgtcgtcacttttttagacacagataca
gccttaatcacggatgttgacatgatgcgaatcctttcagttttattgatctatttatgc
tcgctaaatgcgtggggcaacacattactggttgtcggtgatagcttgagcgcgggctat
caaatgcgggcagaacaaagctggccggtgttactgcaacccgcattaaagcaacaaggt
cacgaaatcaccgttgtaaatgccagtatttcaggcgatacaacaggaaacggcttggct
cgattgcctacattattacaacaacataaaccagcttacgtcataattgaactcggggcg
aatgatggcttacgtggtttccctcaaggtactatacgtaacaatctcagccaaatgatc
actgaaattcaaaatgctgatgccaagccaatgctcgtgcagataaaagtgccgcccaat
tacggcaaacgctacagtgatatgttcagttctatttaccctcaactcagtaaagagtta
gccacaccactgttacctttctttttagagcagatcattttaaaacaagaatggatgatg
aatgacggtttgcatcctaaatctgatgctcagccatggattgccgaatatatggctgag
aatatcgcgccttatttataa

DBGET integrated database retrieval system