KEGG   Photobacterium profundum: PBPRA2816Help
Entry
PBPRA2816         CDS       T00173                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppr  Photobacterium profundum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppr01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3261814..3262554
Genome map
AA seq 246 aa AA seqDB search
MPAPETPTSAIVSPCSTSRETSCKMVSEDDAVVTFLDTDTALITDVDMMRILSVLLIYLC
SLNAWGNTLLVVGDSLSAGYQMRAEQSWPVLLQPALKQQGHEITVVNASISGDTTGNGLA
RLPTLLQQHKPAYVIIELGANDGLRGFPQGTIRNNLSQMITEIQNADAKPMLVQIKVPPN
YGKRYSDMFSSIYPQLSKELATPLLPFFLEQIILKQEWMMNDGLHPKSDAQPWIAEYMAE
NIAPYL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgcgccagagacgccaacaagtgctattgtttctccttgctcgacctcgagggaa
acatcctgcaagatggtgagtgaggacgatgccgtcgtcacttttttagacacagataca
gccttaatcacggatgttgacatgatgcgaatcctttcagttttattgatctatttatgc
tcgctaaatgcgtggggcaacacattactggttgtcggtgatagcttgagcgcgggctat
caaatgcgggcagaacaaagctggccggtgttactgcaacccgcattaaagcaacaaggt
cacgaaatcaccgttgtaaatgccagtatttcaggcgatacaacaggaaacggcttggct
cgattgcctacattattacaacaacataaaccagcttacgtcataattgaactcggggcg
aatgatggcttacgtggtttccctcaaggtactatacgtaacaatctcagccaaatgatc
actgaaattcaaaatgctgatgccaagccaatgctcgtgcagataaaagtgccgcccaat
tacggcaaacgctacagtgatatgttcagttctatttaccctcaactcagtaaagagtta
gccacaccactgttacctttctttttagagcagatcattttaaaacaagaatggatgatg
aatgacggtttgcatcctaaatctgatgctcagccatggattgccgaatatatggctgag
aatatcgcgccttatttataa

DBGET integrated database retrieval system