KEGG   Photobacterium profundum: PBPRA2962Help
Entry
PBPRA2962         CDS       T00173                                 

Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphatereductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppr  Photobacterium profundum
Pathway
ppr00900  Terpenoid backbone biosynthesis
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01130  Biosynthesis of antibiotics
Module
ppr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PBPRA2962
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PBPRA2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Epimerase Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CAG21296
UniProt: Q6LN30
Position
1:complement(3395913..3397106)
Genome map
AA seq 397 aa AA seqDB search
MRKLTILGATGSIGSSTLAVAAQNPQLFEVVALAAGTNSQKMLELCRIWKPKYAAMASLQ
AAKELSVLLEKHEISTQVLAGDAGLCQVAALDEIDTVMAAIVGAAGLLPTMAGVKAGKRI
LLANKEALVMSGQMFIDACEQYGAELLPVDSEHNAIFQCLPADIQRAMGRCDLEEYGISK
ILLTGSGGPFRYTDIAELASVTPQMAIAHPNWSMGPKISVDSATMMNKGLEYIEARWLFN
ASREQLQVIIHPQSVIHSMVQYKDGSVLAQMGLPDMQTPIACAMSYPDRVDAGVAPLDFS
KIGEFTFLPPDYSRYPCLKLAIDACYDGQAATTALNAANEIAVAAFLNNDIGFTDIAIIN
EQILNSANMATLVDLESVIELDMQARVLAHNIIRKVA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagttaacgattcttggtgctactggctctattggaagtagtacattggctgtt
gcagcacagaacccgcaattgtttgaggttgttgctttagctgccggtacaaatagtcag
aaaatgctcgagttatgccgtatctggaaaccaaaatacgcggcaatggcatctctacag
gcagcgaaggaattgtcagtattactggagaagcatgaaattagtacccaagttctagcg
ggtgacgctgggctctgccaagtcgctgctcttgatgaaattgatactgtcatggccgca
atagtaggggctgctggtttattaccgacaatggctggtgtgaaagcgggtaaacgcatt
ttattagcgaacaaagaagctttggtaatgtctggccagatgtttattgatgcgtgtgag
caatatggtgcagagctattacctgttgatagtgagcataatgctatcttccaatgctta
cctgctgatattcagcgtgcaatggggcgttgtgatctggaagagtacggtattagtaaa
atcttactaacgggctctggtggaccatttaggtatactgatatagctgaattggcatca
gttacgccgcagatggcaattgcacatcctaattggtctatgggaccaaaaatctctgtc
gattccgcaaccatgatgaacaaagggcttgaatatattgaagctcggtggttgttcaat
gcgtctagagagcagctgcaagtgattattcacccacagtccgtgattcactccatggtg
caatacaaagacggctcagtattagcgcagatgggattacccgatatgcagacgcccatt
gcgtgtgcaatgtcctatccagatagagttgatgctggcgttgcgccattagacttcagt
aagattggcgaatttacgttcttgccgccagactattcacgctacccctgtctgaaactc
gccattgatgcgtgttatgacggtcaagcggccacaacggcattgaatgctgcgaacgaa
atagcggttgcggcgtttttaaataatgacattgggtttaccgatattgcgataattaat
gaacagatacttaactctgccaatatggcaacactggtagacttagaaagtgtgattgag
ttagatatgcaggctcgtgttttggctcacaacataattcgtaaggtagcatga

DBGET integrated database retrieval system