KEGG   Photobacterium profundum: PBPRA3073Help
Entry
PBPRA3073         CDS       T00173                                 

Gene name
PCM
Definition
(GenBank) putative L-isoaspartate protein carboxylmethyltransferase type II
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PBPRA3073 (PCM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 MTS DREV CMAS Methyltr_RsmB-F GCD14 NodS Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: CAG21389
UniProt: Q6LMT7
Position
1:complement(3511965..3512594)
Genome map
AA seq 209 aa AA seqDB search
MRYAKERHNLMVILQRHGIRNEKVLNAIASVPRELFIDEAFSHQAYENNALPIGSGQTIS
QPYIVGKMTELLELTAQSHVLEVGTGSGYQTAVLAQLVDHVYSVERIKALQWQAKRRLKQ
LNLHNISTKHGDGWKGWHNKGPFDAIIVTAAAEEMPMELLAQLTDGGRLVIPVGDDLQVL
KKITRNGEQFVSQDIEAVRFVPLVAGDLA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgcgaaagaacgacataacttgatggttattttacaacgtcatggtattcga
aatgagaaagtactcaatgcaatagccagcgttccaagagaactgtttattgatgaggct
ttttctcaccaagcgtatgagaataatgcattacccatcggaagcggacagaccatttct
caaccttatatcgtcggtaagatgacagagttactcgaattaacggcacaatcacacgtg
ttggaagttggcactggctcgggctaccaaaccgcggtactcgcccaattagttgatcat
gtatattcagttgagcgtattaaagcactacaatggcaagctaaacgccgtctaaaacaa
ttaaatctccataatatatcgactaaacatggggatggatggaaaggttggcataataaa
ggcccatttgatgccattattgttaccgcagccgcagaagaaatgccgatggaattattg
gcgcagcttactgacggtggacggttagttattcctgttggcgatgacttacaagtatta
aaaaagatcactcgtaatggcgaacagtttgtttctcaagatattgaagccgttaggttt
gttcctttggttgccggagatttagcataa

DBGET integrated database retrieval system