KEGG   Photobacterium profundum: PBPRA3151Help
Entry
PBPRA3151         CDS       T00173                                 

Gene name
SF1569
Definition
(GenBank) putative glutaminase family protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ppr  Photobacterium profundum
Pathway
ppr00220  Arginine biosynthesis
ppr00250  Alanine, aspartate and glutamate metabolism
ppr00471  D-Glutamine and D-glutamate metabolism
ppr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PBPRA3151 (SF1569)
   00220 Arginine biosynthesis
    PBPRA3151 (SF1569)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PBPRA3151 (SF1569)
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PBPRA3151 (SF1569)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CAG21466
UniProt: Q6LML1
Position
1:complement(3585407..3586327)
Genome map
AA seq 306 aa AA seqDB search
MKPTKELLAGILDEVRPLIGQGKVADYIPALAGISATKLGIAVCYNDGEIIQAGDTQERF
SIQSISKVMSLTLAMSLYEPEEIWRRVGKEPSGHAFNSMIQLELENGIPRNPFINAGALV
VSDLLHSRLAAPQYRMLELVRKLSCNPHLTYDKAVAASEMQHSDRNASIAYLMRSFGNFE
NEVMPVLTNYFSYCSLNMSCIDLARTFSYLANKGLPLGAKKTIISQTQSKQMNALLATCG
LYDGAGEFAYRVGMPGKSGVGGGIVAIVPGEMSITVWSPELDPSGNSLAGTAALELLAER
IGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaacaaaagagttgctcgctggtattttggatgaagtgagaccactaatcggt
caaggaaaggtcgcagattatattcctgcattggccggtatttctgccactaaattaggt
attgccgtgtgttataacgatggcgaaatcatccaagccggagacactcaagaacgtttc
tctattcaatcaatctctaaggtaatgtcactcacattagccatgagcctatatgaacca
gaagaaatttggcgacgtgttggtaaagagccttctggccatgcatttaattcgatgatc
cagcttgaacttgaaaatggtattccacgcaatccattcatcaatgctggcgcgttagtg
gtatccgatttattgcatagtcgtttagctgcgccacaatatcggatgctagaactcgtt
cgaaaactgtcttgtaatccccatttaacctacgacaaagcggttgctgcgtctgaaatg
cagcacagcgaccgcaatgcatcaattgcgtatttaatgcgttctttcggtaattttgaa
aatgaagtgatgcctgttttaaccaattattttagttactgttcactaaacatgagctgt
attgatttagctcgtacattcagttacttagcaaacaaagggcttcctttaggcgcgaaa
aaaactattatcagccagactcagagtaagcaaatgaatgcattgcttgcaacgtgtgga
ttatatgacggtgcaggtgagtttgcttatcgtgtgggtatgccgggcaaatcgggtgta
ggtggcggaattgttgctatcgtgccgggtgaaatgtcgataacggtgtggtcacctgag
ctggatccttctggtaactcgttggcaggcacagctgcattagaattactcgccgaacgt
attgggcgatcaattttttaa

DBGET integrated database retrieval system