KEGG   Photobacterium profundum: PBPRA3449Help
Entry
PBPRA3449         CDS       T00173                                 

Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ppr  Photobacterium profundum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PBPRA3449
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PBPRA3449
    3.5.1.-  
     PBPRA3449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3899113..3899742
Genome map
AA seq 209 aa AA seqDB search
MIIAAIDVDPQKAFTPLCPNELPVNEGDIIGPALNAQARKANFRVLTKDAHQSKAIWTVD
NHSQMLQPLDHPNADLTWVSHAVPGTRGFETIPELPAVTDYDFVVWKGIEADLHPYGACY
HDIAEQLSTGLIEWLIAKEVDTVLIGGLATDYCVKTTALQLVKNKQFKVIINVEACRGIA
TETIELAYKEMSQAGITIIQNINDLQIHL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattattgcagccattgatgttgacccacaaaaagcatttactcctctttgcccaaat
gagcttccagtaaatgagggtgatatcattggtccagcgttaaacgcacaagcaagaaaa
gcaaattttcgtgtgctcacaaaagatgcccatcaatcgaaggctatatggactgtcgat
aatcattctcaaatgttacagcctttagatcatccgaatgctgacttaacttgggtatca
catgcggtacctggcacaagaggctttgagactatcccagagcttccagcagtcactgat
tatgatttcgttgtatggaaaggtatagaagcagatctacatccatacggagcctgttat
cacgacatagcagagcagcttagtactgggcttatcgaatggctcatagctaaagaagta
gatactgttttgattggtggtcttgctactgattattgtgtaaagacaactgcactgcaa
ttagttaaaaataagcaattcaaggtcatcattaacgtagaggcttgtcgaggaatagcg
acagaaacaatagaattagcttacaaagaaatgtctcaggccggcattaccatcattcaa
aatattaatgacttacaaatacatttataa

DBGET integrated database retrieval system