KEGG   Photobacterium profundum: PBPRA3529Help
Entry
PBPRA3529         CDS       T00173                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppr  Photobacterium profundum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PBPRA3529
Enzymes [BR:ppr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PBPRA3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3989776..3990522
Genome map
AA seq 248 aa AA seqDB search
MITRPEPDCHELTQQLNAAGINAIAQPLLTIKAGNDLPDLINQLKKLKTDDFLIVISVHA
VNLAHNYLMSQDVCWPKNVHYIAVGHKTATTLQRVTGQKVISPQTRCDSEGLLALPELAN
VTDRQILILRGNGGRELIHQTLTERNAKVSYCETYQRTWLALNGEALCRTWQAQNVSTLV
VTSGEQLAYLTHLVPKQYLTWFFQCHLFVPSQRIANQAKNLGYKNFSTVGSASNKALFTF
LSKIGSMG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgatcacccgtccagaaccggattgccacgaactcacccagcaactcaatgctgcgggg
atcaatgctattgctcaaccgttactcacaatcaaggctggcaatgacctaccagacttg
attaatcagttaaaaaagttgaaaactgatgattttctgattgttatcagtgttcatgca
gtcaatttggcccacaattatttgatgtcacaggatgtctgctggccaaaaaacgtgcat
tatatagccgttggacataaaacagccacaacgttacagagagtgacaggtcaaaaggtc
atctctccacaaacgcgttgcgatagcgaagggttactcgcgctgcctgaattggctaat
gtaactgatcgccaaatccttattttacgaggaaatggcgggcgagaactgatccatcaa
acgctaacagaacgcaatgcaaaagtaagttactgtgaaacttaccagcgcacttggcta
gcattaaatggagaggcactttgccgcacttggcaggcacagaatgtgtcaactttagtg
gtgacgagcggtgaacaactcgcgtatttaacacatttagttccaaaacaatatctgact
tggttttttcaatgtcaccttttcgtaccaagccagcgtattgctaaccaagccaaaaac
cttggttataaaaatttttccaccgtgggtagtgcttcaaataaagcactcttcacgttc
ctaagtaagataggctcgatgggataa

DBGET integrated database retrieval system