KEGG   Photobacterium profundum: PBPRB0018Help
Entry
PBPRB0018         CDS       T00173                                 

Gene name
Z5721
Definition
(GenBank) putative alpha-galactosidase (melibiase)
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
ppr  Photobacterium profundum
Pathway
ppr00052  Galactose metabolism
ppr00561  Glycerolipid metabolism
ppr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PBPRB0018 (Z5721)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PBPRB0018 (Z5721)
   00600 Sphingolipid metabolism
    PBPRB0018 (Z5721)
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PBPRB0018 (Z5721)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C 3HCDH_N Ldh_1_N OTCace Spermine_synth TRA-1_regulated
Motif
Other DBs
NCBI-ProteinID: CAG21891
UniProt: Q6LKK5
Position
2:complement(26221..27603)
Genome map
AA seq 460 aa AA seqDB search
MTQITIIGAGSVMFTRQITSALLSYPALNDIDLVLMDIDPEVLKRSHQLISKMAEQANTH
ARISMTTNRRQALTGADFVINAIQVGGLEPWRLDMQIPTKYGVIQEVGDTMGPGGIFRAL
RHIPPMLAILRDMEEVCPEALFINYANPLAPLTWAAKDSSPIKSIGLCYGVRYTAAQLVG
YLGEGDWVEHPSTPERWQRLMYHDVPSHIDYEFAGINHMTWITKMMANGKDMQPKIRELF
NNQKVYAADGVRCEVLKFFGLWCTENHWHCSDYLPYFRKNEEMINHFLPQRWDLLALEEK
VHSAGEAEIDAQLAGIQKFTIEPNMLNAPKLINAMVSGERTRINGNVPNRQSAGLLIDNL
PENCVVEVPIWVDSQGIHPQKMGRLPMQCASLIKTNTAVQELIVEAALTCDLDAARYALA
LDPVTATVCTLEQIDAMFTEMFTAQRQWLPQFANVPSITQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgactcagataaccattatcggtgcgggtagtgtaatgttcacccgccagattacttcg
gccttactctcttatccggcattgaacgatattgacttggtgttgatggatatcgatcct
gaagtacttaaaagaagccatcagcttattagtaaaatggctgagcaggctaatactcat
gctcggatcagtatgaccacaaataggcgtcaggcgttgaccggtgccgactttgtgatt
aatgccattcaggttggaggtttagagccgtggcgactggatatgcagattccgaccaag
tacggtgtaatacaagaagttggcgataccatggggccgggtggcatctttcgagctcta
cgccatatccccccaatgttggcaatattgcgagacatggaagaggtatgccccgaggcg
ttgtttatcaactatgccaacccactcgcaccattaacttgggctgcaaaagattccagc
ccaattaaatctatcggtttgtgttatggcgtgcgctataccgcggctcaacttgtcggg
tatttaggtgaaggcgattgggtagagcatccatcaacccccgaacgctggcaacgactg
atgtatcacgatgtaccttcgcacattgactatgaattcgcgggcattaatcacatgacg
tggataaccaaaatgatggcgaatggcaaagatatgcagcctaaaatccgtgaattgttt
aataatcagaaagtctacgctgctgatggtgtgcgctgtgaagtactgaaattttttggt
ttatggtgcacagaaaaccactggcactgtagcgattacctaccctatttccgtaaaaat
gaagagatgattaatcatttccttcctcagcgctgggatttattggcgttggaagaaaaa
gtccattctgctggtgaagctgaaattgacgcccagttggcagggatacaaaagtttacg
attgagccgaatatgctgaatgcaccgaagctgattaacgcaatggtcagcggtgaacgg
acacgaatcaatggtaatgtgccgaatcgtcagtctgcaggtttgttgatcgataactta
cctgaaaactgtgttgttgaggtaccgatttgggttgatagccaagggattcatccgcag
aaaatgggccgtttacctatgcaatgtgctagtttgatcaaaaccaataccgcggtacaa
gagttaattgttgaagcggcactgacttgtgatcttgatgctgcacggtatgctttggct
cttgatccggtaacggcaacagtgtgcacccttgagcaaattgatgcgatgtttacggaa
atgtttactgcacagcgtcaatggttgccacagtttgccaatgtaccgtcaattacacag
tag

DBGET integrated database retrieval system