KEGG   Photobacterium profundum: PBPRB0018Help
Entry
PBPRB0018         CDS       T00173                                 

Definition
alpha-galactosidase (melibiase)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppr  Photobacterium profundum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PBPRB0018
  Lipid metabolism
   00561 Glycerolipid metabolism
    PBPRB0018
   00600 Sphingolipid metabolism
    PBPRB0018
Enzymes [BR:ppr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PBPRB0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(26221..27603)
Genome map
AA seq 460 aa AA seqDB search
MTQITIIGAGSVMFTRQITSALLSYPALNDIDLVLMDIDPEVLKRSHQLISKMAEQANTH
ARISMTTNRRQALTGADFVINAIQVGGLEPWRLDMQIPTKYGVIQEVGDTMGPGGIFRAL
RHIPPMLAILRDMEEVCPEALFINYANPLAPLTWAAKDSSPIKSIGLCYGVRYTAAQLVG
YLGEGDWVEHPSTPERWQRLMYHDVPSHIDYEFAGINHMTWITKMMANGKDMQPKIRELF
NNQKVYAADGVRCEVLKFFGLWCTENHWHCSDYLPYFRKNEEMINHFLPQRWDLLALEEK
VHSAGEAEIDAQLAGIQKFTIEPNMLNAPKLINAMVSGERTRINGNVPNRQSAGLLIDNL
PENCVVEVPIWVDSQGIHPQKMGRLPMQCASLIKTNTAVQELIVEAALTCDLDAARYALA
LDPVTATVCTLEQIDAMFTEMFTAQRQWLPQFANVPSITQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgactcagataaccattatcggtgcgggtagtgtaatgttcacccgccagattacttcg
gccttactctcttatccggcattgaacgatattgacttggtgttgatggatatcgatcct
gaagtacttaaaagaagccatcagcttattagtaaaatggctgagcaggctaatactcat
gctcggatcagtatgaccacaaataggcgtcaggcgttgaccggtgccgactttgtgatt
aatgccattcaggttggaggtttagagccgtggcgactggatatgcagattccgaccaag
tacggtgtaatacaagaagttggcgataccatggggccgggtggcatctttcgagctcta
cgccatatccccccaatgttggcaatattgcgagacatggaagaggtatgccccgaggcg
ttgtttatcaactatgccaacccactcgcaccattaacttgggctgcaaaagattccagc
ccaattaaatctatcggtttgtgttatggcgtgcgctataccgcggctcaacttgtcggg
tatttaggtgaaggcgattgggtagagcatccatcaacccccgaacgctggcaacgactg
atgtatcacgatgtaccttcgcacattgactatgaattcgcgggcattaatcacatgacg
tggataaccaaaatgatggcgaatggcaaagatatgcagcctaaaatccgtgaattgttt
aataatcagaaagtctacgctgctgatggtgtgcgctgtgaagtactgaaattttttggt
ttatggtgcacagaaaaccactggcactgtagcgattacctaccctatttccgtaaaaat
gaagagatgattaatcatttccttcctcagcgctgggatttattggcgttggaagaaaaa
gtccattctgctggtgaagctgaaattgacgcccagttggcagggatacaaaagtttacg
attgagccgaatatgctgaatgcaccgaagctgattaacgcaatggtcagcggtgaacgg
acacgaatcaatggtaatgtgccgaatcgtcagtctgcaggtttgttgatcgataactta
cctgaaaactgtgttgttgaggtaccgatttgggttgatagccaagggattcatccgcag
aaaatgggccgtttacctatgcaatgtgctagtttgatcaaaaccaataccgcggtacaa
gagttaattgttgaagcggcactgacttgtgatcttgatgctgcacggtatgctttggct
cttgatccggtaacggcaacagtgtgcacccttgagcaaattgatgcgatgtttacggaa
atgtttactgcacagcgtcaatggttgccacagtttgccaatgtaccgtcaattacacag
tag

DBGET integrated database retrieval system