KEGG   Photobacterium profundum: PBPRB0050Help
Entry
PBPRB0050         CDS       T00173                                 

Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppr  Photobacterium profundum
Brite
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PBPRB0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:63815..65158
Genome map
AA seq 447 aa AA seqDB search
MVMVVILTTVVACNDSSDDTLNNDELNNETPTVVSDSTVNAEESTENSEENNTSPPDDTI
DPSPADPPPEEPIVQLFDKDGLPLPDLSINHDYEAYLNARPSYYMDAGARFGNVIDQDNT
PADNNVTNAGAVLGRVLFYDIRLSANNTVACASCHIQRHGFSDPEVLSNGFDGGKTGRHS
MGLTNATYYSRGRFFWDERAGTLEEQVLMPIQDSVEMGMNLFDLEVKLGLTSFYAPLFLA
AFSDEAITSDRISRSLAQFIRSMVSYGSKYDQAFTAGGSDTPDFSAVFSEQELLGLRLFS
GVPDDNSDSLGCDTCHQTSAHAADNKHVNGLDANTSADQGVGGGFFKVPSLRNIAVRAPY
MHDGRFSSLAEVIEFYNSGVQAHPNLAPALRRRNSSNGRPVQFNLNQAEKEALVVFLEAL
TDEAFLVNPIFSNPFPEVINEESEPES
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
ttggttatggtcgttattttgactactgttgttgcctgcaatgatagttctgatgacaca
ttgaataacgacgagctaaacaatgaaactcccactgtcgtttccgatagtactgtaaat
gcagaagaaagcactgaaaattctgaggaaaataatacctcaccgcctgatgatactatt
gatccatcaccagcagaccctccaccagaagagccgatagtacagctattcgataaggat
ggtttaccactgcctgatttgagtattaaccacgattacgaagcatatttaaatgcgaga
ccaagctattacatggatgcaggcgctcgttttggtaatgtgatcgatcaagataacacg
ccagcggacaataacgttacaaatgccggagcagtgcttggtcgagtgcttttctatgat
attcgtttgtcggctaacaatactgttgcttgtgcatcttgccatattcagcggcatgga
ttctctgatcctgaagtgctgagtaatggctttgatggtggtaaaacaggtcgtcattct
atggggttaaccaatgccacctattattctagaggtcgtttcttctgggatgagcgagcg
ggtacgctagaagagcaggtattaatgcccattcaagatagtgttgaaatgggaatgaat
ttattcgaccttgaagttaagttgggacttaccagtttttatgctcctctatttttagcg
gcattcagtgacgaggccattaccagcgatcgtatatcaagatcgctagcgcagtttatt
cgctctatggtgagttacggttctaaatatgatcaagcttttacggcaggaggctctgat
actccggattttagtgctgttttttctgaacaagaattattaggcttacgtcttttttct
ggtgtgccagatgataattcagattcacttggctgtgatacttgtcaccagacatcagct
catgcggccgataataaacacgtgaacgggttagatgccaatacaagtgcagatcaaggc
gtgggaggtggtttctttaaagtgccttcattgcgtaatatcgcggtaagagccccttat
atgcatgatggtcgttttagtagcttagctgaagtgattgaattttataatagtggtgtt
caggcgcaccctaatttagcccctgcgctaaggcgaagaaattcttctaatggccgtccg
gtgcagtttaatcttaatcaagcagagaaagaggcgttagtggtgtttcttgaagcatta
acagacgaagcgtttttagtgaaccctatctttagtaatccttttcctgaggttattaat
gaagaaagcgagcctgaatcataa

DBGET integrated database retrieval system